mpidb The Microbial Protein Interaction Database EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation b7umb3_eco27 Type 3 secretion system secretin escC sctC E2348C_3955 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKKISFFIFTALFCCSAQAAPSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSKAKNKDVVKVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPSTGKGAVERSGNLFDNSVTISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVSIIDVDANDLQQLGVNWSGTLNAGQGTIAFNSSTAQANISSSVISNASNFMIRVNALQQNSKAKILSQPSIITLNNMQAILDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDSSNSLTGKRRERVRLLLDIQDGNQSTNQSNAQDASSTLPEVQNSEMTTEATLSAGESLLLGGFIQDKESSSKDGIPLLSDIPVIGSLFSSTVKQKHSVVRLFLIKATPIKSASSE FBFDE283F1D04118 b7uma5_eco27 E2348C_3947 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLDRILSIRKSRANRLRESMAKINSQIKEVDGKLDDCEQSIKESIASKQAYCASLVNLDKVSLYKYQIKNNAFDEQKQRLYEKKSSLSKEKRSLLDSQKRTKENLQHVNKSVEKLSFAIKEHYFD 1B6084FA2D7BADA8 b7uma5-escc 2 3 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait b7uma5-- B7UMA5-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5A b7uma5-escc-2 1 3 unspecified role unspecified role prey prey b7umb3-- B7UMB3-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5