InnateDB InnateDB Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Nat. Immunol. (1529-2908) 2012 imex curation Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-neutrophil Homo sapiens polymorphonuclear neutrophil neutrophil Neutrophil [Neutrophilic granulocyte] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu Accepted 2012-JUL-25 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Nat. Immunol. (1529-2908) 2012 imex curation Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu Accepted 2012-JUL-25 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Bidirectional regulation of neutrophil migration by mitogen-activated protein kinases. Nat. Immunol. (1529-2908) 2012 imex curation Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu X., Ma B., Malik A.B., Tang H., Yang T., Sun B., Wang G., Minshall R.D., Li Y., Zhao Y., Ye R.D., Xu J. jingsong@uic.edu Accepted 2012-JUL-25 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2012 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity mk13_human Mitogen-activated protein kinase 13 MAPK13 PRKM13 SAPK4 Stress-activated protein kinase 4 Mitogen-activated protein kinase p38 delta protein protein human Homo sapiens Human MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL 52E749EDB2973DDF fpr1_human fMet-Leu-Phe receptor FPR1 N-formyl peptide receptor N-formylpeptide chemoattractant receptor protein protein human Homo sapiens Human METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK 06651DF820B1CBD1 mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP DIP protein P27361 original sequence version: 171 DIP protein P27361 original sequence version: 101 DIP protein P27361 original sequence version: 124 DIP protein P27361 original sequence version: 129 DIP protein P27361 original sequence version: 143 E6020CE413EC41F7 arbk1_human Beta-adrenergic receptor kinase 1 GRK2 ADRBK1 BARK BARK1 G-protein coupled receptor kinase 2 protein protein human Homo sapiens Human MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLACSHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL DIP protein P25098 original sequence version: 156 DIP protein P25098 original sequence version: 124 4DB68F62841AFA7D fpr1-mapk13 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 7C. SB203580 and stimulated with fMLF fpr1-adrbk1 3 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 7F. fMLF fpr1-adrbk1-1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P21462:p.Ser342Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:44:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser342asp' Tue Jun 30 19:28:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser342Asp' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey association association Fig. 7G. fpr1-mapk3 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. S8C. fpr1-mapk13-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. S7B. fMLF fpr1-adrbk1-2 1 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. S7C. fMLF