mpidb The Microbial Protein Interaction Database The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. J. Bacteriol. (0021-9193) 2012 imex curation Busiek K.K., Eraso J.M., Wang Y., Margolin W. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Busiek K.K., Eraso J.M., Wang Y., Margolin W. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. J. Bacteriol. (0021-9193) 2012 imex curation Busiek K.K., Eraso J.M., Wang Y., Margolin W. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Busiek K.K., Eraso J.M., Wang Y., Margolin W. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. J. Bacteriol. (0021-9193) 2012 imex curation Busiek K.K., Eraso J.M., Wang Y., Margolin W. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Busiek K.K., Eraso J.M., Wang Y., Margolin W. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. The early divisome protein FtsA interacts directly through its 1c subdomain with the cytoplasmic domain of the late divisome protein FtsN. J. Bacteriol. (0021-9193) 2012 imex curation Busiek K.K., Eraso J.M., Wang Y., Margolin W. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Busiek K.K., Eraso J.M., Wang Y., Margolin W. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsa-ftsn-3 3 6 unspecified role unspecified role bait bait region glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region P29131-1-55 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain p29131-- P29131-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3 ftsa-ftsn-2 3 5 unspecified role unspecified role prey prey region P29131-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait p0abh0-- P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1B ftsn-ftsa-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey p0abh0-- P0ABH0-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region P0ABH0-80-140 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain p0abh0-- P0ABH0-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5 ftsn-ftsa-2 4 5 unspecified role unspecified role bait bait p29131-1-128 P29131-1-128 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association figure 2 ftsn-ftsa-3 2 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal P29131-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region P29131-1-33 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:36:57 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'p29131-1-33' 6 unspecified role unspecified role prey prey p0abh0-- P0ABH0-- glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction figure 4 The cytoplasmic domain of FtsN (1-33) is necessary and sufficient for interaction with FtsA, but only if the cytoplasmic domain is in a parallel homodimer.