IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-neuronal_precursor_cells(stem cells) Mouse Neuronal precursor cells/neural stem progenitor cells neuronal_precursor (stem cells) Neuronal Precursor Cells/neural stem progenitor cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. RYBP-PRC1 complexes mediate H2A ubiquitylation at polycomb target sites independently of PRC2 and H3K27me3. Cell (0092-8674) 2012 imex curation Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-fibroblast Mus musculus fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tavares L., Dimitrova E., Oxley D., Webster J., Poot R., Demmers J., Bezstarosti K., Taylor S., Ura H., Koide H., Wutz A., Vidal M., Elderkin S., Brockdorff N. Chromatin - Epigenetic interactions resulting in chromatin modulation Data involving Histones 2 and 3 could not be captured as this could not be ascribed to a single gene product. sarah.elderkin@babraham.ac.uk, neil.brockdorff@bioch.ox.ac.uk Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Cell (0092-8674) 2012 Only protein-protein interactions imex curation cdx2_mouse_gene Homeobox protein CDX-2 gene gene gene mouse Mus musculus Mouse nkx22_mouse_gene Homeobox protein Nkx-2.2 gene gene mouse Mus musculus Mouse ring1_mouse E3 ubiquitin-protein ligase RING1 Ring1 Ring1A Rnf1 RING finger protein 1 Polycomb complex protein RING1 Transcription repressor Ring1A RING-type E3 ubiquitin transferase RING1 protein protein mouse Mus musculus Mouse MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK 4F274E976974A2D8 cbx2_mouse Chromobox protein homolog 2 Cbx2 M33 Modifier 3 protein protein protein mouse Mus musculus Mouse MEELSSVGEQVFAAECILSKRLRKGKLEYLVKWRGWSSKHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKHTVTSSCSRRSKLKEPDAPSKSKSSSSSSSSTSSSSSSDEEEDDSDLDSKRGPRGRETHPVPQKKAQILVAKPELKDPIRKKRGRKPLPPEQKAARRPVSLAKVLKTTRKDLGTSAAKLPPPLSAPVAGLAALKAHTKEACGGPSTMATPENLASLMKGMAGSPSRGGIWQSSIVHYMNRMSQSQVQAASRLALKAQATNKCGLGLDLKVRTQKGGELGGSPAGGKVPKAPGGGAAEQQRGNHSGSPGAQLAPTQELSLQVLDLQSVKNGVPGVGLLARHAPAKAIPATNPATGKGPGSGPTGANMTNAPTDNNKGEKLTCKATALPAPSVKRDTVKSVAASGGQEGHTAPGEGRKPPALSELSTGEENSSSDSDPDSTSLPSAAQNLSVAIQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSVGFFNLRHY DIP protein P30658 original sequence version: 76 F89EF3CEF14ACA72 msx1_mouse_gene Homeobox protein MSX-1 gene gene mouse Mus musculus Mouse ring2_mouse E3 ubiquitin-protein ligase RING2 Rnf2 DinG Ring1b RING finger protein 2 RING finger protein 1B RING-type E3 ubiquitin transferase RING2 protein protein mouse Mus musculus Mouse MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK DIP protein Q9CQJ4 original sequence version: 124 DIP protein Q9CQJ4 original sequence version: 115 84BA5B3E044DB7EC pcgf2_mouse Polycomb group RING finger protein 2 Pcgf2 Mel18 Mel-18 Rnf110 Zfp144 Znf144 DNA-binding protein Mel-18 Melanoma nuclear protein 18 RING finger protein 110 Zinc finger protein 144 protein protein mouse Mus musculus Mouse MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALGDDEIVSLSIEFYEGVRDREEKKNLTENGDGDKEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEILYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPTVPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSPTPPSTAAGTTTATNGGTSNCLQTPSSTSRGRKMTVNGAPCPP DIP protein P23798 original sequence version: 79 C23031B8B9E30108 cbx7_mouse Chromobox protein homolog 7 Cbx7 D15Ertd417e protein protein mouse Mus musculus Mouse MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL DIP protein Q8VDS3 original sequence version: 58 A40021F05B16BEAF ezh2_mouse Histone-lysine N-methyltransferase EZH2 Ezh2 Enx1h Enhancer of zeste homolog 2 ENX-1 protein protein mouse Mus musculus Mouse MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKTMFSSNRQKILERTETLNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPAQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPDEREEKQKDLEDNRDDKETCPPRKFPADKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTISVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPTEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP 7442C751E13EA24B rybp_mouse RING1 and YY1-binding protein Rybp Dedaf Death effector domain-associated factor protein protein mouse Mus musculus Mouse MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF 80E4D647244E213D phc3_mouse Polyhomeotic-like protein 3 Phc3 protein protein mouse Mus musculus Mouse MDSEPSSGTSVSTTASSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSSAAQYLQQMYAAQQQHLMLHTAALQQQHLSSSQLQSLAAVQASLSSGRPSTSPTGSVTQQSSMSQTSILSASPAPAQLMNRSQTSSSTSGSITQQTMLLGSTSPTLTASQAQMYLRAQMLIFTPATTVAAVQSDIPVVSSSPSPSCQSAAAQVQNLTLRSQKLGVLSSSQNGSPKSAGQTQSLTICHNKTTVTSSKISQRDPSPESKKGGSPGLESRSTAVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPPKVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNHGLSPAPSNAQPQHCSPVQSHPPPLTVSPNQAQSAQQSVVVSPPPPHSPSQSPTIIIHPQALIQPHPLVSSALQTGPNLQQAAADQVQSTAQLNLPSHLPLPASPVVHIGPVQQSALVSPGQQMVSPTSHQQYSALQSSPIPIATPPQMSASPPAQLPPLPLQSMQSLQVQPEILSQGQVLVQNALVSEEELPAAEALVQLPFQTLPPPQTVAVNLQVQPPAPVDPPVVYQVEDVCEEEMPEESDECARMDRTPPPPTLSPAAVTVGRGEDLTSEHPLLEQVELPAVASVSASVIKSPSDPTHASAPAPPLLIPAASTRSSSTSLASSTPSLENKPPQAIVKPQILTHVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVVNSVCVQPELQNNTKHADNSSDTEIEDMMAEETLEEMDSELLKCEFCGKMGYPNEFLRSKRFCTMSCAKRYNVSCSKKFALSRWNRKPDNQSLGHRGRRPSGPEGAAREHILRQLPITYPSAEEDVASHEDPVPSAMTTRLRRQSERERERELRDVRIRKMPENSDLLPVAQTEPSIWTVDDVWAFIHSLPGCQDVADEFRAQEIDGQALLLLKEDHLMSAMNMKLGPALKICARINSLKDS 6FB97F04595ED7E3 sox1_mouse_gene gene gene mouse Mus musculus Mouse Not currently in Ensembl (03/12) phc1_mouse Polyhomeotic-like protein 1 Phc1 Edr Edr1 Rae28 Early development regulatory protein 1 RAE-28 protein protein mouse Mus musculus Mouse METESEQNSSSTNGSSSSGASSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNSSTAQQQTATTQASMNLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPPAQSPGVHADADQVQNLAVRNQQASAQGPQMPGSTQKAIPPGASPVSGLSQTSSQALAVAQASSGASGQSLNLSQAGGGSGNSLPGSMGPGGGGQAPGGLGQLPSSGLTGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQSVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQQQQQQQQQQGTTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLTLPPEPTSKPPIPIQSKPPVAPIKPPQLGAAKMSATQQPPPHIPVQVVGTRQPGSAQAQALGLAQLAAAVPTPRGITGAVQPGQAHLASSPPSSQAAPGALQECPPALAAGMTLAPVQGTAHVVKGGPTASSPVVAQVPAAFYMQSVHLPGKAQTLAVKRKAESEEERDDLSALASVLPTKASPAAESPKVIEEKNSLGEKAEPVASLNANPPNSDLVALAPTPSAPPPTLALVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQFLKETEKPLQAGLPTGLNESQPSGPLGGDSPSVELEKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNTITTPSTPELQGINPVFLSSNPSQWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET DIP protein Q64028 original sequence version: 119 5DA12A87D0B5FDDB hxa7_mouse_gene Homeobox protein Hox-A7 gene gene mouse Mus musculus Mouse pcgf1_mouse Polycomb group RING finger protein 1 Pcgf1 Nspc1 Rnf68 RING finger protein 68 Nervous system Polycomb-1 protein protein mouse Mus musculus Mouse MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVSQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGKDKNKNVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR B631543B0DEA2954 phc2_mouse Polyhomeotic-like protein 2 p36 Early development regulatory protein 2 Phc2 Edr2 Ph2 protein protein mouse Mus musculus Mouse MENELPVPHTSNRASVTTNTSGTNSSSGCISSSGGGGGSGGRPTAPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQHLMLQTAALQQQHLSSAQLQSLAAVQQASLVANRQGSTPGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMYLRAQMLIFTPTATVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPPTQPVLPSLALKPTPSSSQPLPAPPQGRTMAQGSPAGAKPSGTDNAPETLKAGDGNCNMEGRPGPGRAVPAVATHPLIAPAYAHLQSHQLLPQPPAKHPQPQFVAQQQPQPPRPAPQVQSQPQLASVSPSLALQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQNGHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAEKSVPVARPGPSPHQQAIIPAIPGGLPGPKSPNIQQCPAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTAPQNGENKPPQAIVKPQILTHVIEGFVIQEGAEPFPVGRSSLLVGNLKKKYAQGFLPEKPPQQDHTTTTDSEMEEPYLQESKEEGTPLKLKCELCGRVDFAYKFKRSKRFCSMACAKRYNVGCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTLTKDTKKQPSGTVPLSVTAALQLAHSQEDSSRCSDNSSYEEPLSPISASSSTSRRRQGQRDLDLPDMHMRDLVGVGHHFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS 87746AFD7808DC7B pcgf6_mouse Polycomb group RING finger protein 6 Pcgf6 Mblr Rnf134 RING finger protein 134 Mel18 and Bmi1-like RING finger protein protein mouse Mus musculus Mouse MDEAETDATENKRASEAKRASAMPPPPPPPPPISPPALIPAPAAGEEGPASLGQAGAAGCSRSRPPALEPERSLGRLRGRFEDYDEELEEEEEMEEEEEEEEEMSHFSLRLESGRADSEDEEERLINLVELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNIRLDRQLQDIVYKLVINLEEREKKQMHDFYKERGLEVPKPAAPQPVPSSKGKTKKVLESVFRIPPELDMSLLLEFIGANEDTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLERYQTLREIRRAIGDTAMQDGLLVLHYGLVVSPLKIT 0D29B7FE065B5448 cbx4_mouse E3 SUMO-protein ligase CBX4 Cbx4 Pc2 Chromobox protein homolog 4 Polycomb 2 homolog E3 SUMO-protein transferase CBX4 protein protein mouse Mus musculus Mouse MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKGQGHQYELNSKKHHQYQPHSKERSGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGTKSHPPDKWAHGAAAKGYLGAVKPLGGGAGAPGKGSEKGPPNGMTPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEAAEGEARSPSHKKRAAEERHPQGDRTFKKAAGASEEKKAEVPCKRREEEALVSGDAQPQDLGSRKLSPTKEAFGEQPLQLTTKPDLLAWDPARSSHPPAHHHHHHHHHHHHHTVGLNLSHARKRCLSETHGEREPCKKRLTARSISTPTCLGGSPVSEHPANVSPTAASLPQPEVILLDSDLDEPIDLRCVKMRSDAGEPPSTLQVKPEAPAVAAVVAPAPASEKPPAEAQEEPVEPLSEFKPFFGNIIITDVTANCLTVTFKEYVTV 382F8305FD803CF3 cbx8_mouse Chromobox protein homolog 8 Cbx8 Pc3 Polycomb 3 homolog protein protein mouse Mus musculus Mouse MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPKKRGPKPKTFLLKAQAKAKAKTYEFRSDSTRGIRIPYPGRSPQDLASTSRAREGLRNTGLPPPGSSTSTCRADPPRDRDRERDRGTSRVDDKPSSPGDSSKKRGPKPRKEPLDPSQRPLGEPSAGLGEYLKGRKLDETSSGTGKFPAGHSVIQLARRQDSDLVQYGVTSPSSAEASSKLAVDTFPARVIKHRAAFLEAKGQGALDPGGARVRHSSGTPASVGSLYRDMGAQGGRPSLIARIPVARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR EE047F57483741B2 atoh1_mouse_gene Protein atonal homolog 1 gene gene mouse Mus musculus Mouse gata4_mouse_gene Mouse gata4 gene gene gene mouse Mus musculus Mouse pax3_mouse_gene Paired box protein Pax-3 gene gene mouse Mus musculus Mouse rnf2-cdx2 2 8 acceptor acceptor prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 and reduced occupancy of RING1B on this gene. rnf2-hxa7 2 21 unspecified role unspecified role prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-msx1 2 13 acceptor acceptor bait bait 12 unspecified role unspecified role prey prey association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-gata4 2 13 acceptor acceptor bait bait 28 unspecified role unspecified role prey prey association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-nkx22 2 9 unspecified role unspecified role prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-atoh1 2 27 unspecified role unspecified role prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-pax3 2 29 unspecified role unspecified role prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. rnf2-sox1 2 19 unspecified role unspecified role prey prey 13 acceptor acceptor bait bait association association Fig. 1A, Supp. Fig. 7B Interaction not observed in absence of Polycomb protein EED. RYBP knockdown led to substantially reduced levels of H2AK119u1 reduced occupancy of RING1B on this gene. pcgf2-cdx2 2 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-hxa7-1 2 14 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey association association Supp. Fig.3B Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-msx1-1 2 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-gata4-1 2 14 unspecified role unspecified role bait bait 28 unspecified role unspecified role prey prey association association Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-nkx22-1 2 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-atoh1-1 2 14 unspecified role unspecified role bait bait 27 unspecified role unspecified role prey prey association association Fig. 1A Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-pax3-1 2 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Fig. 1A, Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-sox1-1 2 14 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association Fig. 1A Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-cdx2 2 16 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-hxa7 2 21 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig.3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-msx1 2 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-gata4-1 2 28 acceptor acceptor prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-nkx22-1 2 16 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-pax3 2 29 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 3B Recruitment of RING1B and EZH2 was retained following MG132 treatment ezh2-sox1-1 2 16 unspecified role unspecified role bait bait 19 acceptor acceptor prey prey association association Supp Fig. 3B Interaction not observed in absence of Polycomb protein EED. Recruitment of RING1B and EZH2 was retained following MG132 treatment pcgf2-cbx2 6 26 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4B, Supp. Fig. 4A pcgf2-cbx2-2 1 25 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Supp. Fig. 4B pcgf2-cbx2-3 4 17 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4C, Supp.Fig. 4B cbx7-pcgf2-7 3 15 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component physical association physical association Supp. Fig. 4C cbx7-rnf2-2 3 17 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component physical association physical association Supp Fig. 4D Complex present in both Polycomb protein EED +/+ and -/- cells. rybp-pcgf1 6 22 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey association association Fig. 4B cbx7-pcgf2-4 6 20 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey association association Fig. 4B rybp-pcgf1-1 4 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 4C cbx7-pcgf2-3 4 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig. 4B rybp-pcgf2 5 17 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 5A, Supp. Fig. 5A cbx7-pcgf2-8 5 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association Fig. 5A, Supp Fig. 5A rnf2-cbx7 5 20 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey association association Fig. 5A, Supp Fig. 5A Interaction occurs in EED +/+ and -/- cells. pcgf2-cbx7-2 5 14 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 5A, Supp. Fig. 5A Interactions were observed in EED +/+ and -/- cells. rnf2-cbx7-1 7 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Supp Fig. 5B Interaction occurs in EED +/+ and -/- cells. rnf2-cbx7-2 7 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association Supp Fig. 5B Interaction occurs in EED +/+ and -/- cells. rybp-cdx2 2 8 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-hxa7 2 17 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-msx1 2 12 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-b2mg-1 2 28 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-nkx22 2 17 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-atoh1 2 27 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-pax3 2 29 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy. rybp-sox1 2 17 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association Fig. 6A Supp Fig. 6A, 6B Interaction was unaffected following conditional depletion of H3K27me3 and in MG132-treated cells demonstrating that H2AK119u1 is not required for RYBP occupancy.