MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. FEBS Lett. (0014-5793) 2012 imex curation Singh S., Ashish null., Dikshit KL. suggested by lperfetto Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Singh S., Ashish null., Dikshit KL. suggested by lperfetto FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. Pro42 and Val45 of staphylokinase modulate intermolecular interactions of His43-Tyr44 pair and specificity of staphylokinase-plasmin activator complex. FEBS Lett. (0014-5793) 2012 imex curation Singh S., Ashish null., Dikshit KL. suggested by lperfetto Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Singh S., Ashish null., Dikshit KL. suggested by lperfetto FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation plmn_human Plasminogen PLG protein protein human Homo sapiens Human MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 8B31CB877CCB3AB6 sak_staan Staphylokinase sak SA1758 protein protein staan Staphylococcus aureus (strain N315) MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDSKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK mint 413CDAE14BE9FD40 plg-sak 2 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Pro69Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Tue Jul 12 10:08:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:32:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro69leu' Tue Jun 30 18:19:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro69Leu' Pg 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction mint However, the binding constants could not be calculated for Val45Ala and Pro42Leu mutants as the sensorgrams of these mutants showed almost no binding t2 sf1 sf2 plg-sak-1 2 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Val72Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:50:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:53:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val72ala' Tue Jun 30 17:49:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val72Ala' Pg 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction mint However, the binding constants could not be calculated for Val45Ala and Pro42Leu mutants as the sensorgrams of these mutants showed almost no binding t2 sf1 sf2 plg-sak-2 2 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q99SU7:p.Val72Tyr mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V Y Tue Jul 12 10:50:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:01:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val72tyr' Tue Jun 30 20:03:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val72Tyr' Pg 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction mint t2 sf2 plg-sak-3 1 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Pg 3 predetermined featur predetermined feature predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction mint t1 f2a f2b plg-sak-4 1 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Pro69Leu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Tue Jul 12 10:11:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:08:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro69leu' Tue Jun 30 20:02:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro69Leu' Pg 3 predetermined featur predetermined feature predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction mint t1 f2a f2b Surprisingly, all the mutants showed much diminished Pg activation ability as compared to native SAK as evident from their activation profile (Fig. 2A). When preformed complexes of SAKPro42 and Val45 were used with Pm, these complexes exhibited extremely slow progression and a significant lag (10 min as compared to 2 min in native SAK) in Pg activation suggesting attenuation in catalytic activity of activator complexes formed by these SAK mutants (Fig. 2B) plg-sak-5 1 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Val72Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:51:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:50:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val72ala' Tue Jun 30 17:29:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val72Ala' Pg 3 predetermined featur predetermined feature predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction mint t1 f2a f2b Surprisingly, all the mutants showed much diminished Pg activation ability as compared to native SAK as evident from their activation profile (Fig. 2A). When preformed complexes of SAKPro42 and Val45 were used with Pm, these complexes exhibited extremely slow progression and a significant lag (10 min as compared to 2 min in native SAK) in Pg activation suggesting attenuation in catalytic activity of activator complexes formed by these SAK mutants (Fig. 2B) plg-sak-6 1 SAK 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined stimulator stimulator neutral component neutral component purified purified Q99SU7:p.Tyr71Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:51:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr71phe' Tue Jun 30 18:27:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr71Phe' Q99SU7:p.Val72Phe mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V F Tue Jul 12 10:10:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:48:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val72phe' Tue Jun 30 15:40:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val72Phe' Pg 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified direct interaction direct interaction mint t1 f2a f2b Surprisingly, all the mutants showed much diminished Pg activation ability as compared to native SAK as evident from their activation profile (Fig. 2A). When preformed complexes of SAKPro42 and Val45 were used with Pm, these complexes exhibited extremely slow progression and a significant lag (10 min as compared to 2 min in native SAK) in Pg activation suggesting attenuation in catalytic activity of activator complexes formed by these SAK mutants (Fig. 2B)