IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Exp. Cell Res. (0014-4827) 2012 imex curation Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2012 Only protein-protein interactions imex curation Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Exp. Cell Res. (0014-4827) 2012 imex curation Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-svec Human saphenous vein endothelial cells svec Saphenous vein endothelial cells confocal microscopy confocal microscopy immunostaining immunostaining Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in Accepted 2012-APR-30 by JYOTI Exp. Cell Res. (0014-4827) 2012 Only protein-protein interactions imex curation Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis. Exp. Cell Res. (0014-4827) 2012 imex curation Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jain M., Bhat G.P., Vijayraghavan K., Inamdar M.S. None of the interactions or co-localizations involving beta-tubulin have been put in because there was no way to ascertain which particular form of tubulin was detected. inamdar@jncasr.ac.in Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2012 Only protein-protein interactions imex curation bcas3_human BCAS3 microtubule associated cell migration factor Breast carcinoma-amplified sequence 3 BCAS3 GAOB1 protein protein human Homo sapiens Human MNEAMATDSPRRPSRCTGGVVVRPQAVTEQSYMESVVTFLQDVVPQAYSGTPLTEEKEKIVWVRFENADLNDTSRNLEFHEIHSTGNEPPLLIMIGYSDGMQVWSIPISGEAQELFSVRHGPIRAARILPAPQFGAQKCDNFAEKRPLLGVCKSIGSSGTSPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKRILVVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWLAYAENKLIRCHQSRGGACGDNIQSYTATVISAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVAIHSNSRRSPLVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGHDFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFPINPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSYNNFTNNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPYLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCYGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQYYQFLLAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNFDGYRSPLPTNESQPLSLFPTGFP 00D82E2EDCD1E8D7 vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A bcas3-vim 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 3i-k, 3m-o, S4b-e and S4h-i vim-bcas3 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 3r bcas3-vim-1 1 4 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey physical association physical association 3s