IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 imex curation Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis Paper is not open access, ask me for the pdf whenever you want to check it. The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. pithi_chan@yahoo.com 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis Paper is not open access, ask me for the pdf whenever you want to check it. pithi_chan@yahoo.com Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 Only protein-protein interactions imex curation Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. Caveolin-1 regulates Mcl-1 stability and anoikis in lung carcinoma cells. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 imex curation Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis Paper is not open access, ask me for the pdf whenever you want to check it. The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. pithi_chan@yahoo.com 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 confocal microscopy confocal microscopy immunostaining immunostaining Chunhacha P., Pongrakhananon V., Rojanasakul Y., Chanvorachote P. Apoptosis - Interactions involving proteins with a function related to apoptosis Paper is not open access, ask me for the pdf whenever you want to check it. pithi_chan@yahoo.com Accepted 2012-SEP-12 by JYOTI 11-Oct-2012: Contacted by IntAct-Help. The experiment was performed in both the wild-type H460 cell line and in a stably transfected line expressing high amounts of YFP-tagged caveolin. Am. J. Physiol., Cell Physiol. (0363-6143) 2012 Only protein-protein interactions imex curation mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI DIP protein P49817 original sequence version: 94 DIP protein P49817 original sequence version: 143 DIP protein P49817 original sequence version: 168 CF88FE9B1D3D67AE cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 cav1-mcl1-1 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 3b mcl1-cav1 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 3b mcl1-cav1-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 3b Interaction detected in the HCav-1 cell line, expressing large amounts of YFP-tagged caveolin. cav1-mcl1-2 1 4 unspecified role unspecified role bait bait c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 3 unspecified role unspecified role prey prey physical association physical association 3b Interaction detected in the HCav-1 cell line, expressing large amounts of YFP-tagged caveolin. cav1-mcl1-3 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 3d cav1-mcl1-4 2 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization 3c and 3d