IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. Cell (0092-8674) 2012 imex curation Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Accepted 2012-FEB-09 by PPORRAS Cell (0092-8674) 2012 Only protein-protein interactions imex curation HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. Cell (0092-8674) 2012 imex curation Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag immunost anti tag immunostaining anti tag immunost Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Accepted 2012-FEB-09 by PPORRAS Cell (0092-8674) 2012 Only protein-protein interactions imex curation HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. HSF-1 Regulators DDL-1/2 Link Insulin-like Signaling to Heat-Shock Responses and Modulation of Longevity. Cell (0092-8674) 2012 imex curation Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chiang W.C., Ching T.T., Lee H.C., Mousigian C., Hsu A.L. aolinhsu@umich.edu Accepted 2012-FEB-09 by PPORRAS Cell (0092-8674) 2012 Only protein-protein interactions imex curation q9u3b7_caeel hsb-1 K08E7.2 CELE_K08E7.2 protein protein caeel Caenorhabditis elegans MSDEKSTTPTAQLDAPADGNMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVEHPPSAQ 31251472E410EC70 hsf1_caeel Heat shock transcription factor hsf-1 hsf-1 Y53C10A.12 protein protein caeel Caenorhabditis elegans MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKSSVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHISDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCFVQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKENRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGPNSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGSAQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGPLTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQPQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPHQNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHNWDDFGNNVPLDDDEEGSEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPALRTPSPSDPNLV CEFC67160982ACB1 wasc3_caeel WASH complex subunit homolog 3 F59E12.10 ddl-1 Daf-16-dependent longevity protein 1 protein protein caeel Caenorhabditis elegans MNASSRTKPAIDLNKVPPIDHHRTAVTFNCLIMKMTEMLNNFGNKMEDILEKAEQSLDTADRKLRLMESKLAGMSLEDKSTTATPSSAPEIDEIHESNPSSSQIVEETVEEKPEEHTTTVLIKDDPAYSKYFKMLKLGVLEAGVIQKMKSEGVDPSILKRGDEPSRPQAQTSRNYESSGESTASFSDSD D83A072806B01543 wash1_caeel WASH complex subunit homolog 1 ddl-2 Y48E1B.1 protein protein caeel Caenorhabditis elegans MYHVPLIPRDAGREETIFRINQSLQKLLRVSDEIFDRVEHRITRIHGKAEAIDRRTEVLEKKLESLQESDKVITFTLPRQLPKLPEEPPTSTSLFRINIDTEHFPGSEELPAFRRADDHVLRPCEPIDFTYELNKPDKFFLTSQVLKEYEQKGWERYKKRLLGGLRELSRSPEHIAELFYAGTSIPAFEGVSGDFSKKALDADDDGGTSRSGRTTDELAQLRLHEQLLEDTALSSTLMQEDSLDDNHPLAFRINFNEKKKKTAKMVEMPDSLPNLKGHAHDFTLRDPEIDEDRLLDILPADDQIPEASEPTEAEADAPTTFILPPPPPPMKLDPSPQPAATPVEITEIPPIISPPAPPPPPPPPPPPPPPQTPSASSSVTFSPTKSVDGGRSDLMAAIRAAGGAGNAKLSRIAEKPKRKGKFDGILESSALLGASETPRNSAPAPDGGGGGGDLMSALSKALDARRKAINGKVEAQPPAKVSSTIPAPPNFDDEEWD 785BCB7AC0341AD0 ddl_2-ddl_1-2 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A, Supp. Fig. 4B ddl_1-ddl_2 1 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 4A, 4E ddl_1-hsb_1 1 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B hsb_1-ddl_1-2 1 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4B ddl_1-hsf_1 1 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4C hsf_1-ddl_1 1 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O01901:p.Thr182Ala mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:06:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr182ala' Tue Jun 30 17:05:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr182Ala' physical association physical association Fig. 4C, 5D, SUpp. Fig. 4C ddl_1-hsf_1-1 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4D, 5A, Supp. 4A Depletion of daf-2 or akt-1 decreased the interaction strength. Depletion of hsb-1prevents interaction from occuring. ddl_1-ddl_2-1 2 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4E