IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. Cell (0092-8674) 2012 imex curation Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2012 Only protein-protein interactions imex curation The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. Cell (0092-8674) 2012 imex curation Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2012 Only protein-protein interactions imex curation The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. Cell (0092-8674) 2012 imex curation Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2012 Only protein-protein interactions imex curation The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. The Mitochondrial Phosphatase PGAM5 Functions at the Convergence Point of Multiple Necrotic Death Pathways. Cell (0092-8674) 2012 imex curation Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Wang Z., Jiang H., Chen S., Du F., Wang X. HeLa cells extracts treated with the necrosis-inducing agents (TNF-α/Smac mimetic/Z-VAD), were fractionated by centrifugation. The RIP3-containing complex was immune-purified the from the p15 fraction and resolved using a gradient SDS-PAGE gel. wangxiaodong@nibs.ac.cn Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2012 Only protein-protein interactions imex curation q96hs1-1 Serine/threonine-protein phosphatase PGAM5, mitochondrial PGAM5-L PGAM5 Bcl-XL-binding protein v68 Phosphoglycerate mutase family member 5 protein protein human Homo sapiens Human MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS EE20D2F0A99FCD83 pgam5_human Serine/threonine-protein phosphatase PGAM5, mitochondrial Bcl-XL-binding protein v68 PGAM5 Phosphoglycerate mutase family member 5 protein protein human Homo sapiens Human MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS DIP protein Q96HS1 original sequence version: 92 EE20D2F0A99FCD83 ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN DIP protein Q13546 original sequence version: 158 DIP protein Q13546-1 original sequence version: 140 DIP protein Q13546 original sequence version: 146 DIP protein Q13546-1 original sequence version: 146 DIP protein Q13546 original sequence version: 134 DIP protein Q13546 original sequence version: 109 976E2428D525A9B2 dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 F9521A376B785B71 mlkl_human Mixed lineage kinase domain-like protein MLKL protein protein human Homo sapiens Human MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK 005E7F7AB6D20649 ripk3_human Receptor-interacting serine/threonine-protein kinase 3 RIPK3 RIP3 RIP-like protein kinase 3 Receptor-interacting protein 3 protein protein human Homo sapiens Human MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK DIP protein Q9Y572 original sequence version: 134 BF755F8A0B1810A1 q96hs1-2 Serine/threonine-protein phosphatase PGAM5, mitochondrial PGAM5-S PGAM5 Bcl-XL-binding protein v68 Phosphoglycerate mutase family member 5 protein protein human Homo sapiens Human MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCSIPPLLSAGDFVLLGS Ref.2 (AAH08196) sequence is in conflict in position: 252:L->V. 07B881D6D8BE033C ripk3-mlkl-5 4 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 2C ripk3-mlkl-7 2 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig. 2B,2D I have merged 2B and 2D as the exp description is identical - it just seems to be same samples, more Abs. I have not added the kinase/phosphatase assay as gel 2C shows this to be a messy prepn. ripk3-mlkl-8 3 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association Fig. 2B,2D I have merged 2B and 2d as the exp description is identical - it just seems to be same samples, more Abs. ripk3-ripk1 1 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association Fig. 2F Cells were treated with (TNF-α/Smac mimetic/Z-VAD). pgam5-pgam5 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A Cells were treated with (TNF-α/Smac mimetic/Z-VAD). Necrosulfonamide pgam5-ripk1 1 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey physical association physical association Fig. 4A Cells were treated with (TNF-α/Smac mimetic/Z-VAD). dnm1l-pgam5 1 11 unspecified role unspecified role unspecified role unspecified role 8 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 5F