MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. EMBO Rep. (1469-221X) 2012 imex curation Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. Only protein-protein interactions human-sk-ut-1 SK-UT-1_Human uterus leiomyosarcoma (GIII) cell line sk-ut-1 SK-UT-1 Human uterus leiomyosarcoma (GIII) cell line https://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=HTB-114&Template=cellBiology Has nonsense mutation in p53 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. EMBO Rep. (1469-221X) 2012 imex curation Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. EMBO Rep. (1469-221X) 2012 imex curation Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. Only protein-protein interactions mouse-r- Mouse R- cells (embryonic fibroblasts lacking type-1 IGF receptor) r- Mouse R- cells (embryonic fibroblasts lacking the type-1 IGF receptor ) Mouse embryonic fibroblasts lacking the type-1 IGF receptor. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. EMBO Rep. (1469-221X) 2012 imex curation Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. Nuclear IGF1R is a transcriptional co-activator of LEF1/TCF. EMBO Rep. (1469-221X) 2012 imex curation Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Warsito D., Sjöström S., Andersson S., Larsson O., Sehat B. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E igf1r_human Insulin-like growth factor 1 receptor Insulin-like growth factor I receptor IGF1R protein protein human Homo sapiens Human MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC DIP protein P08069 original sequence version: 170 DIP protein P08069 original sequence version: 109 DIP protein P08069 original sequence version: 139 DIP protein P08069 original sequence version: 185 AE8A735F87F745C8 irs1_mouse Insulin receptor substrate 1 Irs1 Irs-1 protein protein mouse Mus musculus Mouse MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAPKRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAHHDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRLHPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYILSRGGNGHRYIPGANLGTSPALPGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSVASIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTSNLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMMMSPSGSCSPDIGGGSSSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKLLPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGARHQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSLTHPHHHVLQPHLPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSLHPPEPKSPGEYVNIEFGSGQPGYLAGPATSRSSPSVRCPPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRIGPAPPGSATVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEKASLPRPTGAAPPPSSTASSSASVTPQGATAEQATHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAKVIRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGGSGGGGGGGSEDVKRHSSASFENVWLRPGDLGGVSKESAPVCGAAGGLEKSLNYIDLDLAKEHSQDCPSQQQSLPPPPPHQPLGSNEGNSPRRSSEDLSNYASISFQKQPEDRQ DIP protein P35569 original sequence version: 136 DIP protein P35569 original sequence version: 120 C0E9B2D890DADD87 lef1_mouse Lymphoid enhancer-binding factor 1 Lef1 Lef-1 protein protein mouse Mus musculus Mouse MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNSDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI DIP protein P27782 original sequence version: 88 DIP protein P27782-1 original sequence version: 103 0CA01B6C528FD7FA lef1_human Lymphoid enhancer-binding factor 1 LEF1 T cell-specific transcription factor 1-alpha protein protein human Homo sapiens Human MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI DIP protein Q9UJU2 original sequence version: 136 DIP protein Q9UJU2 original sequence version: 73 D480D440698EEFE3 igf1r-ctnnb1 2 LEF1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Beta-catenin 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1a homomint mint IGF1R was immunoprecipitated from total cell lyaste and subjected to immunoblotting with anti-b-catenin and anti-LEF1 in DFB, H1299 and HeLa cells. igf1r-ctnnb1-1 2 LEF1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Beta-catenin 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1c homomint mint igf1r-ctnnb1-2 2 IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level Beta-catenin 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint lef1-igf1r 4 LEF1 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1b homomint mint lef1-igf1r-1 3 Lef1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f2d mint igf1r-irs1-3 3 IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:10:44 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Tyr950Phe Irs1 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2d mint lef1-igf1r-2 1 LEF1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P08069:p.Lys1150Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:18:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:26:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1150arg' Tue Jun 30 16:46:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1150Arg' P08069:p.Lys1130Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:18:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:41:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1130arg' Tue Jun 30 15:46:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1130Arg' P08069:p.Lys1055Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:55:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:07:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1055arg' Tue Jun 30 18:26:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1055Arg' physical association physical association f3c homomint mint igf1r-lef1 5 IGF1R 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level LEF1 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association homomint mint f1b f1d f2a