MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. EMBO Rep. (1469-221X) 2012 imex curation Kietzmann A., Wang Y., Weber D., Steinbeisser H. Only protein-protein interactions xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kietzmann A., Wang Y., Weber D., Steinbeisser H. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. EMBO Rep. (1469-221X) 2012 imex curation Kietzmann A., Wang Y., Weber D., Steinbeisser H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kietzmann A., Wang Y., Weber D., Steinbeisser H. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. Xenopus paraxial protocadherin inhibits Wnt/β-catenin signalling via casein kinase 2β. EMBO Rep. (1469-221X) 2012 imex curation Kietzmann A., Wang Y., Weber D., Steinbeisser H. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling predetermined predetermined participant predetermined Kietzmann A., Wang Y., Weber D., Steinbeisser H. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation csk2b_xenla Casein kinase II subunit beta csnk2b Phosvitin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTMR mint E46371E699B0E0EC b7u6l7_xenla Protein sprouty homolog 1 spry1.S spry1 XELAEV_18009321mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MELQSQHGIGGSLVVIQQPSLDSRQRFDYEREVQPTAILSLDQIKALRSRNEYTEGPSMVKKTGPKTVPRHIKQERTHEIIPINVNNNNEHRPTHWAHTGHLPNGRAPGLSRSTSTGSAASSASTNSASSEQELLGQCPPPRSASGHRTERIVRMQPKASALPVEDLKSSIKMDYSQHRFICEQCGKCKCGDCTAPRTLPSCLACNRQCLCSAESMVEYSTCMCLVKAAFYHCSNDDEGDSYADNPCSCTQSHCWSRYLCMGVMSIFLPCLLCYPPAKGCLKLCRECYDRVNRPGCRCKNSNTVYCKLDDVPRGQGKPS mint C13DDF23D3CD67F3 b5tr11_xenla PAPC protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MLLLFRAIPMLLLGLMVLQSDCQIAQYYIDEEEPPGTVIAVLSQHSIFNTTDIPATNFRLMKQFNNSLIGVRESDGQLSIMERIDREQICRQSLHCNLALDVVSFSKGHFKLLNVKVEVRDINDHSPHFPSEIMHVEVSESASVGTRIPLEIAIDEDVGSNSIQNFQISNNSHFSIDVLTRADRVKYADLVLMRELDREIQPTYIMELLAMDGGVPSLSGTAVVNIRVLDFNDNSPVFERSTIAVDLVEDAPLGYLLLELHATDDDEGVNGEIVYGFSTLASQEVRQLFKINSRTGSVTLEGQVDFETKQTYEFEVQAQDLGPNPLTATCKVTVHILDVNDNTPAITITPLTTVNAGVAYIPETATKENFIALISTTDRDSGSNGQVRCTLYGHEHFKLQQAYEDSYMIVTTSTLDRENIAEYTLTVVAEDLGFPSLKTKKYYTVKVSDENDNAPVFSKPQYEASILENNAPGSYITTVIARDSDSDQNGKVNYRLVDAKVMGQSLTTFVSLDADSGVLRAVRSLDYEKLKQLDFEIEAADNGIPKLSTRVQVNLRIVDQNDNCPVITNPLLNNGSGEVLLPISAPQNYLVFQLKAEDSDEGHNSQLFYTILRDPSRLFAINKESGEVFLKKQLNSDHSEDLSIVVAVYDLGRPSLSTNATVKFILTDSFPSNVEVVILQPSAEEQHQTDMSIIFIAVLAGGCALLLLAIFFVACTCKKKAGEFKQVPEQHGTCNEERLLSTPSPQSVSSSLSQSESCQLSINTESENCSVSSNQEQHQQTGIKHSISVPSYHTSGWHLDNCAMSISGHSHMGHISTKDSGKGDSDFNDSDSDTSGESQKKSIEQPMQAQASAQYTDESAGFRHADNYFSHRINKGPENGNCTLQYEKGYRLSYSVAPAHYNTYHARMPNLHIPNHTLRDPYYHINNPVANRMHAEYERDLVNRSATLSPQRSSSRYQEFNYSPQISRQLHPSEIATTF mint C28792D4F46825BB papc-csnk2b 3 PAPC 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CK2b 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint no f papc-csnk2b-1 2 CK2b 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PAPC 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association f1a f1b mint papc-spry1 2 PAPC 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPRY1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1a mint papc-csnk2b-2 1 PAPC 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CK2b 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1c mint