I2D I2D Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Oncogene (0950-9232) 2012 imex curation Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Accepted 2012-SEP-06 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Oncogene (0950-9232) 2012 imex curation Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Accepted 2012-SEP-06 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells. Oncogene (0950-9232) 2012 imex curation Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Khanal P., Yun H.J., Lim S.C., Ahn S.G., Yoon H.E., Kang K.W., Hong R., Choi H.S. Cancer - Interactions investigated in the context of cancer Author confirms that Pin1-Wt, WW, PPIase, CDK and mutant constructs are all human. Pin1S16A construct is mouse. chs@chosun.ac.kr Accepted 2012-SEP-06 by MGT 11-Oct-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database cdk10_human Cyclin-dependent kinase 10 CDK10 Serine/threonine-protein kinase PISSLRE Cell division protein kinase 10 protein protein human Homo sapiens Human MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKVRMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELLLGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP 25B28560961103F4 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 pin1_mouse Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 protein protein mouse Mus musculus Mouse MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGGSTVGGSSKNGQGEPAKVRCSHLLVKHSQSRRPSSWRQEKITRSKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGPFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q9QUR7 original sequence version: 81 188E95F009176B1F cdk10-pin1-1 3 4 unspecified role unspecified role bait bait region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b pin1-cdk10 3 5 unspecified role unspecified role bait bait xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b, d pin1-cdk10-1 3 4 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait Q9QUR7:p.Ser16Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:49:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser16ala' Tue Jun 30 18:23:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser16Ala' xpress-tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2d pin1-cdk10-2 1 4 unspecified role unspecified role prey prey region gal4 dna bd gal4 dna binding domain gal4 dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15131:p.Thr133Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A Wed May 02 19:09:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr133ala' Tue Jun 30 18:37:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr133Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2f, g Increasing amounts of calf intestine alkaline phosphatase resulted in decreasing interaction between Pin1 and CDK10. pin1-cdk10-3 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2h Pin1 and CDK10 interaction occurs after stimulation of MCF7 cells with 10% FBS for 4h after starvation. cdk10-pin1-2 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2h Pin1 and CDK10 interaction occurs after stimulation of MCF7 cells with 10% FBS for 4h after starvation.