IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions mouse-kidney Mus musculus kidney kidney [Renal] anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. The Bait - FLAG-BBS2 has been entered as Human in origin, as deduced from Zhang et al., 2012, JBC.(PMID: 22500027 -Supplement) - though this is not stated in this publication. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Bardet-Biedl syndrome 3 (Bbs3) knockout mouse model reveals common BBS-associated phenotypes and Bbs3 unique phenotypes. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 imex curation Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Q., Nishimura D., Seo S., Vogel T., Morgan D.A., Searby C., Bugge K., Stone E.M., Rahmouni K., Sheffield V.C. Diabetes - Interactions investigated in the context of Diabetes the "corresponding" author does not correspond - no point asking Qs. Cells from human BBS patients and nonsyndromic retinal pigmentosa patients. Cell type is not stated. val-sheffield@uiowa.edu Accepted 2012-JUN-25 by ORCHARD Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2011 Only protein-protein interactions imex curation ttc8_human Tetratricopeptide repeat protein 8 TTC8 BBS8 Bardet-Biedl syndrome 8 protein protein protein human Homo sapiens Human MSSEMEPLLLAWSYFRRRKFQLCADLCTQMLEKSPYDQEPDPELPVHQAAWILKARALTEMVYIDEIDVDQEGIAEMMLDENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYIFHHENDVKTIHLEDVVLHLGIYPFLLRNKNHIEKNALDLAALSTEHSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYVSLDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNMSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEIALRFYRRLLQMGIYNGQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHVAVGIGDTNLAHQCFRLALVNNNNHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATISDKIGDLQRSYVAAQKSEAAFPDHVDTQHLIKQLRQHFAML DIP protein Q8TAM2 original sequence version: 114 DIP protein Q8TAM2 original sequence version: 85 013CFB0FDEBF385B pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE DIP protein Q3SYG4 original sequence version: 47 8E333B7680243B7A ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML DIP protein Q8VD72 original sequence version: 76 9A8ACDF59BB641C1 bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D arl6_human ADP-ribosylation factor-like protein 6 ARL6 Bardet-Biedl syndrome 3 protein BBS3 protein protein human Homo sapiens Human MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT 42E37FC7886BF1F0 ctnb1_mouse Catenin beta-1 Beta-catenin Ctnnb1 Catnb protein protein mouse Mus musculus Mouse MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein Q02248 original sequence version: 128 DIP protein Q02248 original sequence version: 135 DIP protein Q02248 original sequence version: 147 DIP protein Q02248 original sequence version: 187 DIP protein Q02248 original sequence version: 140 D708F170A3FBED6E bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS DIP protein Q9CWF6 original sequence version: 63 C91D9B7834B614F4 rab8a_mouse Ras-related protein Rab-8A Rab8a Mel Rab8 Oncogene c-mel protein protein mouse Mus musculus Mouse MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL DIP protein P55258 original sequence version: 143 AC89DC85588FB8F8 bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 322E9DD4DD554813 bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA DIP protein Q8K2G4 original sequence version: 52 F7D8C284B04DA15B pthb1_mouse Protein PTHB1 Bbs9 Pthb1 Bardet-Biedl syndrome 9 protein homolog Parathyroid hormone-responsive B1 gene protein homolog protein protein mouse Mus musculus Mouse MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLNIGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVSSTLDSVSQATNVEPGADSVPSITVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTDRNPDGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFELRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQVIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQELGWEETVDAAIAYLLKTCLSKSSKEQALNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPGGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPEVSARQGVLE 46C4580518630E36 rb11a_mouse Ras-related protein Rab-11A Rab11a Rab11 protein protein mouse Mus musculus Mouse MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI 76FC1E113A29B269 bbs5_mouse Bardet-Biedl syndrome 5 protein homolog Bbs5 protein protein mouse Mus musculus Mouse MSVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS 8FD2BF5943F72325 bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF arl6_mouse ADP-ribosylation factor-like protein 6 Arl6 Bbs3 protein protein mouse Mus musculus Mouse MGLLDRLSGLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQDIVPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKDGQAIIFVIDSSDKLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDSVTSVKVSQLLCLESIKDKPWHICASDAIKGEGLQEGVDWLQDQIQAVKT 4F26947318977386 bbs4_mouse Bardet-Biedl syndrome 4 protein homolog Bbs4 protein protein mouse Mus musculus Mouse MAEVKLGMKTQVPASVESQKPRSKKAPDFPIVEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQCADNLKQVARSLFLLGKHKAATEVYNEAAKLNQKDWEICHNLGVCYTYLKQFNKAQDQLHSALQLNKHDLTYIMLGKIHLLQGDLDKAIEIYKKAVEFSPENTELLTTLGLLYLQLGVYQKAFEHLGNALTYDPANYKAILAAGSMMQTHGDFDVALTKYRVVACAIPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENARRAYVEAVRLDKCNPLVNLNYAVLLYNQGEKKSALAQYQEMEKKVNFLKDNSPLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKTKHRTNSGSKSATLQQPLGSIQALGQAMSSAAAYRKILSGAVGAQLPKPPSLPLEPEPEPTVEASPTEASEQKKEK DIP protein Q8C1Z7 original sequence version: 69 70640E41509F2479 arl6-bbs1-5 1 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 23 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait delta_n_terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9H0F7:p.Gln73Leu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 20:26:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln73leu' Tue Jun 30 16:00:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln73Leu' association association Fig 3A/B/C All BBSome subunits were present in the pull down using the N-terminal deleted BBS3, but none of these were detected in a full-length BBS3 pull down. Mutation of the six hydrophobic amino acids in the first 11 amino acids, to alanine, gives similar results to those observed with the BBS3 N-terminal deletion mutant. (There are seven hydrophobic amino acids within the first eleven amino acids of BBS3.) I cannot enter the alanine mutants as it is not possible to work out which six out of the seven aas were mutated (not stated in this paper - but could mean to exclude N terminal Methionine?). (there are several tables for hydrophobicity and all of them list M,L and V near the top.) arl6-bbs2-1 5 23 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait Q9H0F7:p.Ala89Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain A V Wed May 02 15:50:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala89val' Tue Jun 30 20:22:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala89Val' Q9H0F7:p.Gly169Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G A Wed May 02 20:26:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly169ala' Tue Jun 30 20:17:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly169Ala' n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_n_terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9H0F7:p.Leu170Trp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L W Wed May 02 14:30:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu170trp' Tue Jun 30 17:08:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu170Trp' 22 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association Fig 3D arl6-bbs1-7 4 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_n_terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 3E All BBSome subunits were present in the pull down using the N-terminal deleted BBS3, but none of these were detected in a full-length BBS3 pull down. Mutation of the six hydrophobic amino acids in the first 11 amino acids, to alanine, gives similar results to those observed with the BBS3 N-terminal deletion mutant. (There are seven hydrophobic amino acids within the first eleven amino acids of BBS3.) I cannot enter the alanine mutants as it is not possible to work out which six out of the seven aas were mutated (not stated in this paper - but could mean to exclude N terminal Methionine?). (there are several tables for hydrophobicity and all of them list M,L and V near the top.) arl6-bbs2-6 6 16 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4 Loss of Bbs3 does not affect the general membrane association of the BBSome, and loss of Bbs4 does not affect the general membrane association of Bbs3. bbs2-bbs1-1 7 18 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Fig S3C Loss of Bbs3 does not affect the general membrane association of the BBSome, and loss of Bbs4 does not affect the general membrane association of Bbs3. arl6-bbs1-8 6 21 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S3D Loss of Bbs3 protein did not affect BBSome formation. bbs2-bbs1-1 2 23 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 25 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey association association Fig S3E arl6-bbs2-8 3 22 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S6A I have entered GO term "cytoplasm" as an XREf - after magnifying the image to 300%. -with imagination, it can be seen that band 3 overlaps with all but bbs4 - and band 5 -all mols over lap (??)... (Remove this XREf??) arl6-bbs2-9 6 14 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4-2 Loss of Bbs3 does not affect the general membrane association of the BBSome, and loss of Bbs4 does not affect the general membrane association of Bbs3. arl6-bbs2-10 6 20 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4-3 Loss of Bbs3 does not affect the general membrane association of the BBSome, and loss of Bbs4 does not affect the general membrane association of Bbs3. arl6-ctnnb1 6 24 unspecified role unspecified role neutral component neutral component 20 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 4D Loss of Bbs3 does not affect the general membrane association of the BBSome, and loss of Bbs4 does not affect the general membrane association of Bbs3. arl6-bbs1-9 6 19 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 25 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S3D-2 Loss of Bbs3 protein did not affect BBSome formation. arl6-bbs2-11 3 13 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component 22 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig S6B I have entered GO term "cytoplasm" as an XREf - after magnifying the image to 300%. -with imagination, it can be seen that band 3 overlaps with all but bbs4 - and band 5 -all mols over lap (??)... (Remove this XREf??)