MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. EMBO J. (0261-4189) 2012 imex curation Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. EMBO J. (0261-4189) 2012 imex curation Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. EMBO J. (0261-4189) 2012 imex curation Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. H₂O₂ stress-specific regulation of S. pombe MAPK Sty1 by mitochondrial protein phosphatase Ptc4. EMBO J. (0261-4189) 2012 imex curation Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Di Y., Holmes EJ., Butt A., Dawson K., Mironov A., Kotiadis VN., Gourlay CW., Jones N., Wilkinson CR. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation hog1_schpo Mitogen-activated protein kinase sty1 sty1 hog1 phh1 spc1 MAP kinase spc1 SPAC24B11.06c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAEFIRTQIFGTCFEITTRYSDLQPIGMGAFGLVCSAKDQLTGMNVAVKKIMKPFSTPVLAKRTYRELKLLKHLRHENIISLSDIFISPFEDIYFVTELLGTDLHRLLTSRPLETQFIQYFLYQILRGLKFVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGRDHVNQFSIITELLGTPPMEVIETICSKNTLRFVQSLPQKEKVPFAEKFKNADPDAIDLLEKMLVFDPRKRISAADALAHNYLAPYHDPTDEPVADEVFDWSFQDNDLPVETWKVMMYSEVLSFHNMDNELQS 9A10835FFD381AC0 cox4_schpo Cytochrome c oxidase subunit 4, mitochondrial cox4 SPAC1296.02 Cytochrome c oxidase polypeptide IV protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFMNSMLRVSRQRAAVRSTVSLYRGFVSASIRRNEQNVVKAAAQELANAKEPSDLIGPGGRDGEVPTDLEQATGLERYELLSELSGRDAFDMKPLDASRKGTLTDPIMVTSLDPYRHIGCTGSPSGSHNLIWMTVYKDKLRRCPECGSVYKLKFMGDPNAEHSH mint 0FFEA62B4E5A39F5 hsp60_schpo Heat shock protein 60, mitochondrial hsp60 mcp60 SPAC12G12.04 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVSFLSSSVSRLPLRIAGRRIPGRFAVPQVRTYAKDLKFGVDARASLLTGVDTLARAVSVTLGPKGRNVLIDQPFGSPKITKDGVTVARSVSLKDKFENLGARLVQDVASKTNEVAGDGTTTATVLTRAIFSETVRNVAAGCNPMDLRRGIQLAVDNVVEFLQANKRDITTSEEISQVATISANGDTHIGELLAKAMERVGKEGVITVKEGRTISDELEVTEGMKFDRGYISPYFITDVKSQKVEFENPLILLSEKKVSAVQDILPSLELAAQQRRPLVIIAEDVDGEALAACILNKLRGQLQVVAIKAPGFGDNRRNMLGDLAVLTDSAVFNDEIDVSIEKAQPHHLGSCGSVTVTKEDTIIMKGAGDHVKVNDRCEQIRGVMADPNLTEYEKEKLQERLAKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVLPGAGTSFVKASLRLGDIPTNNFDQKLGVEIVRKAITRPAQTILENAGLEGNLIVGKLKELYGKEFNIGYDIAKDRFVDLNEIGVLDPLKVVRTGLVDASGVASLMGTTECAIVDAPEESKAPAGPPGMGGMGGMPGMM mint May participate in assembly and/or disassembly of proteins imported into the mitochondrion. HSP60 are ATPases and have affinity for unfolded proteins E5434436A98AFDC5 pp2c4_schpo Protein phosphatase 2C homolog 4 ptc4 SPAC4A8.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSIRFLKRLRAPLYIQNAYCSKNYFYRSFIQYYSPSNGPYLKISMNKAPQSLGLCTARGDSPTNQDRMAYGYLNNLKDTTNRDSPFFYGLFDGHGGTECSEFLSTNLGKIIENQDLNDTEKILKEVHSVGGYMAGLKPPFSLRTVLQSRDEDLLWRARLYYSFLQADMDYLTNYARPSPDSAVPGAVGTVAIITSKNNLSYWESDSYIIHLAHVGDTRALLCDSRTGRAHRLTFQHHPADVEEARRLRRYNMGFSRDSFGQKRFAWVANTRSFGDGYKLKKLGVVAEPQLTSIHSLRDDWSFLTLLSDGITDVVSDDEVVDIIKLSESPQDAANNIIRYAQNVGAVDDITCLVVRLPGWKKRTINDFTKNLRLEKSAYHPRRS mint Has a role in the regulation of vacuole fusion 88E00C2BDAE4B9BF cox4-ptc4 4 cox4 6 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptc4 8 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization mint f2d f2e cox4-hsp60 1 sty1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level cox4 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level hsp60 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ptc4 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization mint f3d f3c sf4 hsp60-ptc4 1 sty1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level ptc4 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level hsp60 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization mint f3a f3b ptc4-sty1 3 sty1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ptc4 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell O14156:p.Arg8Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:20:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:35:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg8ala' Tue Jun 30 16:39:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg8Ala' O14156:p.Arg10Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:56:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:10:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala' Tue Jun 30 20:18:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg10Ala' tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O14156:p.Arg27Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:56:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:10:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg27ala' Tue Jun 30 20:11:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg27Ala' physical association physical association f4a mint upon exposure to oxidative stress. sty1-ptc4 2 sty1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptc4 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O14156:p.Arg27Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:58:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:18:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg27ala' Tue Jun 30 19:45:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg27Ala' tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b mint sty1-ptc4-1 2 sty1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ptc4 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated O14156:p.Arg27Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:22:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:37:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg27ala' Tue Jun 30 16:30:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg27Ala' O14156:p.Arg10Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:58:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:51:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg10ala' Tue Jun 30 16:28:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg10Ala' binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O14156:p.Arg8Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:58:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:08:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg8ala' Tue Jun 30 19:43:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg8Ala' tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4b mint