MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. EMBO J. (0261-4189) 2012 imex curation Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. EMBO J. (0261-4189) 2012 imex curation Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. EMBO J. (0261-4189) 2012 imex curation Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. EMBO J. (0261-4189) 2012 imex curation Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. ACBD3-mediated recruitment of PI4KB to picornavirus RNA replication sites. EMBO J. (0261-4189) 2012 imex curation Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sasaki J., Ishikawa K., Arita M., Taniguchi K. jsasaki@fujita-hu.ac.jp EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI 3AA8CBC61F98A6A4 gcp60_human Golgi resident protein GCP60 GOCAP1 GOLPH1 ACBD3 GCP60 Acyl-CoA-binding domain-containing protein 3 Golgi phosphoprotein 1 Golgi complex-associated protein 1 PBR- and PKA-associated protein 7 Peripheral benzodiazepine receptor-associated protein PAP7 protein protein human Homo sapiens Human MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRGEVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSESSDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPGRGVYLLKFDNSYSLWRSKSVYYRVYYTR DIP protein Q9H3P7 original sequence version: 138 DIP protein Q9H3P7 original sequence version: 113 DIP protein Q9H3P7 original sequence version: 88 B36EC550F8268FC2 polg_aiva8 Genome polyprotein protein protein AIVA8 Aichi virus A846/88 Aichi virus (strain A846/88) MAATRVSRSVLAAVAHSAAHRTYHTVLDCYDRLYLNTNPHLSYPLPKNSSFPCPFCQYDEQNEVLSPESLRGEGAEPCWKCSQDKPRRKYNTTPPEDWLYDSDVQSWFYPETYYSDLQQKFFDKLALLSLPGAYQAKTPEERALAGALTQLLNFPSTPPLTLPTTNLQRQGNSVTNIYGNGNNVTTDVGANGWAPTVSTGLGDGPVSASADSLPGRSGGASSEKTHTVSGSSNKVGSRFSKWWEPAAARASESATDSAIEGIDAAGKAASKAITRKLDRPAAPSSTANPQPSLIALNPSATQSGNASILTGSTAPSLLAYPTATPVPLPNPDEPSQPGPSGDRTWLLDTVTWSQEFTRGWNIAGSNGMQWTGLESLIFPVSTDTNWTSTSSPTAYPLPFSFVRAYPDSSWAAMYNTHSMWNCGWRVQVTVNGSQFHAGALILYMVPEATTHAIQTARDNAGFVFPYVILNLYESNTATIEVPYISPTPNTSSGLHAPWTFYLQVLSPLNPPPSLPTSLSCSIYVTPVDSSFHGLRYLAPQHWKTRAVPGAGTFGSAVAGQELPLCGVRAYYPPNAYIPAQVRDWLEFAHRPGLMATVPWTMADEPAERLGIFPVSPSAIAGTGAPISYVISLFSQWRGELAAHLLFTGSAQHYGRLVVCYTPAAPQPPSTMQEAMRGTYTVWDVNAASTLEFTIPFISNSYWKTVDVNNPDALLSTTGYVSIWVQNPLVGPHTAPASALVQAFISAGESFNVRLMQNPALTSQTLTEDLDAPQDTGNIENGAADNSPQPRTTFDYTGNPLPPDTKLENFFSFYRLLPMGGSGAPSLSFPADEGTIIPLNPINWLKGADVSGIAAMLSCFTYIAADLRITLRFSNPNDNPATMLVAFAPPGATIPLKPTRQMLSNFYMAEVPVSAATSTMVSFSIPYTSPLSAIPTSYFGWEDWSGTNFGQLSSGSWGNLMLIPSLSVDSAIPFDFQLSCWVAFGNFKAWVPRPPPPLPPLPTPAANAERTVAVIKQGAASATPDVDPDDRVYIVRAQRPTYVHWAIRKVAPDGSAKQISLSRSGIQALVALEPPEGEPYLEILPSHWTLAELQLGNKWEYSATNNCTHFVSSITGESLPNTGFSLALGIGALTAIAASAAVAVKALPGIRRQGLLTLSADTETNQTLNKITESVNQAAQVVSQFDLSGPANSVSLAASDIREAAHKVASSLNGFTDVIADIKDSLFTRVSDAVESGVATFLTWLVKLFGYLLVLFGSPTPMSISGLLVIICADLAPHAREFFTASGNVLSSLYYWIASKLGLSVTPQECERATLEPQGLKDFNDGALAMRNVEWIGETAWKWAHRLLDWIRGKAKTDPQAKLADVHDEIMLHYSDSILALGSEKLPIDHITKSISRCRELVSIAQEAKSGPHSSFLNQAIKNYTLAISQHRKCQTGPRPEPVVVYLYGPPGTGKSLLASLLAQTLSQRLAGTPDDVYSPSSASCEYFDGYTGQTVHFIDDIGQDPEGRDWANFPNLVSSAPFIVPMASLEEKGTHYTSKVIVVTSNFHEPNERAARSMGALRRRVHLRINVTSNGVPFDPTNALNPIPGTQSKYFTAQTPLTLFQSNTVRLDRDSIWTPTFTNMDELVDAIVTRLDRSTGVSNSLASLIRRQGNRVIDAEPREIPLEYADDLLEAMAHHRPVPCSLGLSQAIANNTPIQQISETFWKYRKPIFTCTTFLAVLGFLCSVIPLARSLWKSKQDTPQEPQAAYSAISHQKPKPKSQKPVPTRHIQRQGISPAVPGISNNVVHVESGNGLNKNVMSGFYIFSRFLLVPTHLREPHHTTLTVGADTYDWATLQTQEFGEITIVHTPTSRQYKDMRRFIGAHPHPTGLLVSQFKAAPLYVRISDNRILDLDFPGVVVCKQAYGYRAATFEGLCGSPLVTDDPSGVKILGLHVAGVAGTSGFSAPIHPILGQITQFATTQQSLIVPTAEVRPGVNVNRMSRLHPSPAYGAFPVKKQPAPLKRNDKRLQEGVDLDTQLFLKHGKGDVTEPWPGLEAAADLYFSTFPTSLPVLTQEQAIHGTPNMEGLDMGQAAGYPWNTLGRSRRSLFDEVEPGVFVPKPELQAEINQTLEDPDYVYSTFLKDELRPTAKVEQGLTRIVEAAPIHAIVAGRMLLGGLIDYMQGRPGEHGSAVGCNPDVHWTSFFYAFSEFSQVYDLDYKCFDATLPSAVFTLVADHLTRITGDPRVGRYIHSIRHSHHIYGNRMYDMIGGNPSGCVATSILNTIINNICVLSALIQHPDFSPSRFHILAYGDDVIYATEPPIHPSFLREFYQKHTPLVVTPANKGQDFPPTSTIYEVTFLKRWFVPDDVRPIYIHPVMDPDTYEQSVMWLRDGDFQDVVTSLCHLAFHSGPKTYAAWCMKVREQCLKSGFAPNFLPYSYLQLRWLNLLAA 44EFBBE1B76D6188 o91464-pro_0000448012 Protein 2B protein protein AIVA8 Aichi virus A846/88 Aichi virus (strain A846/88) GLLTLSADTETNQTLNKITESVNQAAQVVSQFDLSGPANSVSLAASDIREAAHKVASSLNGFTDVIADIKDSLFTRVSDAVESGVATFLTWLVKLFGYLLVLFGSPTPMSISGLLVIICADLAPHAREFFTASGNVLSSLYYWIASKLGLSVTPQECERATLEPQ 1153 1317 01AE9A5946FCB098 o91464-pro_0000448015 Protein 3A protein protein AIVA8 Aichi virus A846/88 Aichi virus (strain A846/88) GNRVIDAEPREIPLEYADDLLEAMAHHRPVPCSLGLSQAIANNTPIQQISETFWKYRKPIFTCTTFLAVLGFLCSVIPLARSLWKSKQDTPQEPQ 1653 1747 F3B027712BAA5AEA pi4kb_human Phosphatidylinositol 4-kinase beta NPIK PI4K92 PI4KIII PI4KB PIK4CB protein protein human Homo sapiens Human MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGGVAVSSRGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRRQNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVENEDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPENRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM CAD8791729BB4308 q63714_rat Golgb1 protein protein rat Rattus norvegicus (Rat) Rat MLSRLSGLANNVLHELSGDYTGWTTMTSSEAELPQGSAMELNNSTQKDVLDRLADAEKLVLELKDIISKQDAQLQQKDEALQEEKKGAESKIKKIKLHAKAKITSLNKQIEELKTQGGAASPPEVQAEELSKHDKSSTEEEMEVEKIKHELQEKEKLISNLQAQLDQAQSEQASQLDKSSAEMEDFILMRQKLQEKEELIGALQTQLSQTQAEQAAQKLRVMQRKLEEHEEALLGRAQVVDLLQKELTSAEQRNQDLSQQLQLLEAEHSTLRNTMEAERQESKILMEKVELEMAERKEELYQLQGQLERAGQAQAELEMQYGTLQQRHETEMEEKTACISLLQKNEQELQSACDALKEENSKLLQEQQEQAAKSAQALQQLEDELQQKSKEISQFVNKPNLEKHETSSQTSLPDVYNEGVQAVMEESVASLQKRVLELENEKGALLLSSLELEELRAENEKLCSRITLLEAQNRAGEADGMVCEVSTAGIALLNRSDSSTEESGQDVLENTFSQKHKELSVLLVEMKEAQEEIAFLKSQLQGKRPEGDYEVLDRKEVQMMESEGLPSVTARDVLCAPRDKNSVPAVEGEQAGMRDQHGTLEAGPLNDTGMELNSPQPDGVDKSLSAPHVCLCHQGELERLKTQVLELETSLHTAKETHEKNLSEKAKEISSLTQLTKEFKESAEEARSTLTAVCEERDQLLYRVKELDVLGELRAQVRELETSLAEAEKQRGLDYESQRAQHNLLTEQIHSLSIEAKSKDVKIETLQRELDGVQLQFSEQGTQIKSLQSQLQTKESEVLEGAERMKDISKEMEELSQALSQKELEIAQMDQLLLEKKKDVETLQQTIQEKDQQVTELSFSMTEKMVQLNEEKFSLGVEIKTLKEQLSLLSRAEGAKREQVEDSGAESSPKHGPHESSAEEPVCKEALQQELEWLRKESEQRKRKLQAALISRKELLQKVSKLEEELAKVREESTKDSLRESEKRELEEDSKNKDDPEKYGTSEWRELEVSLRLTISEKEVELEGIRRDLKEKAAAEEELQALVQRMTQDLQNKTKQIDLLQEEITENQATIQKFITGTMDAGDGDSAVKETSVSSPPRAGGGEHWKPELEGKIVDLEKEKTQLQKKLQEALISRKAILKKAQEKEKHLKEELKEQKDAYRHLQEQFDGQSKENENIRAPLRQLQAKESTDQQLPGTGQQEPTHGSEGLSLEGTEPASESDLHAAQPSHPGETATLQATVSVAQIQDQLKEIEVEKEELELKISSTTSELTKKSEEVLLLQEQINEQGLEIQNLKAASHEAKAHTEQLKQELESSQLKIADLEHLKTLQPELETLQKHVGQKEEEVSYLVGQLGEKEQTLTTVQTEMEEQERLIKALHTQLEMQAKEHEERLKQVQVEICELKKQPKELEEESKAKQQLQRKLQAALISRKEALKENKSLQEQLSSARDAVEHLTKSLADVESQVSVQNQEKDALLGKLALLQEERDKLIVEMDKSLLENQSLGGSCESLKLALGGLTEDKEKLMKELESVRCSKIAESTEWQEKHKELQKEYEVLLQSYENVSNEAERIQHVVESVRQEKQEVYAKLRSAESDKREREKQLQDAEQEMEEMKEKMRKFAKSKQQKILELEEENDRLRAEAQPVGGANESMEALLSSNASLKEELERITLEYKTLSKEFEALMAEKNTLSEETRNLKLQVEAQELKQASLETTEKSDEPKDVIEEVTEAVVGKSQEQDSLSENAKLEDAEATLLANSAKPGVSETFSSHDDINNYLQQLDQLKGRIAELEMEKQKDRELSQTLENEKNALLTQISAKDSELKLLEEEVAKINMLNQQIQEELSRVTKLKETAEEEKDDLEERLMNQLAELNGSIGNYYQDVTDAQIKNEQLESEMQNLKRCVSELEEEKQQLVKEKTKVESEIRKEYMEKIQGAQKGPGSKIHAKELQELLKEKQQEVKQLQKDCIRYLGRISALEKTVKALEFVHTESQKDLDATKGNLAQAVEHHKKAQAELSSFKILLDDTQSEAARVLADNLKLKKELQSNKESIKSQIKQKDEDLLRRLEQAEEKHRKEKKNMQEKLDALHREKAHVEDTLAEIQVSLTRKDKDMKELQQSLDSTLAQLAAFTKSMSSLQDDRDRVIDEAKKWEQRFGDAIQTKEEEVRLKEENCTALKDQLRQMTIHMEELKITVSRLEHDKEIWESKAQTELQHQQKAYDKLQEENKELMSQLEEAGQLYHDSKNELTKLESELKSLKDQSTDLKNSLEKCREHENNLEGIIKQQEADIQNCKFNCEQLETDLTASRELTTRLHDEINVKEQKIISLLSGKEEAIQVAIAELHQQHSKEIKELENLLSQEEEENLTLEEENKRAVEKTNQLTEALETIKKESLEQKAQLDSFVKSMSSLQDDRDRIVSDYRQLEERHLSVILEKDELIQDAAAENNKLKEEIRGLRGHMDDLNSENAKLDAELIQYRRDLNEVITIKDSQQRQLLEAQLQQNKELRNECVKLEGRLKGSEAEKQSLQMSLDALQEENQGLSKEIKSFKEQLTALHEEGALAVYHAQLRVREEEVQKLTAALSSSQKRTVDLQEELVCVQKEASKKVSEIEDKLKRELKHLHHNAGIMRNETETAEERVAELARDLVEMEQKLLTVTKENKDLTAQIQAFGKSMSSLQDSRDHATEELSDLKKKYDASLKELAQLKGRQDLGRESDVLSQAAFPLTTSENISSRLEKLNQQLISKDEQLLHLSSELESSHNQVQSFTKAMTSLQNERDHLWNELEKFRKSEEGKQRSAAPSAASSPAEVQSLKKAMSSLQNDRDRLLKELKNLQQQYLQMNQEITELRPLKAQLQESQDQTKALQMMKEELRQENLSWQHELDQLRVEKNSWELHERRMKEQYLMAISDKDQQLGHLQNLLRELRSSSQTQILPTQYQRQASSGTSAALDGSQNLVYETDCLRTQLNDSLKEIHQKELRIQQLNSKFSQLLEEKNILSTQLRDANQSLRDSQHHYSNLFNHCAILERQVQQLQATGPLNADVAPGAPQEKDGIHIKTETETTGEEQPSFSEVQQQLCNTKHDLSELKKLLEEERDQRLTAENALSLAKEQIRRLEHSEWESARTPIIGACGSQEQVLLMDLPGSSCRRTRSSAGWKRVLRSLCRSRTRVPLLAAIYFLMIHVLLVLCFTGHL mint 48F035DF43647F51 tgon2_human Trans-Golgi network integral membrane protein 2 TGOLN2 TGN46 TGN51 Trans-Golgi network glycoprotein 46 Trans-Golgi network glycoprotein 48 Trans-Golgi network glycoprotein 51 Trans-Golgi network protein 2 protein protein human Homo sapiens Human MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSSAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSKVTRRPKASDYQRLDQKS 6F72467FED83A1A3 o91464-pro_0000448014 Protein 2C protein protein AIVA8 Aichi virus A846/88 Aichi virus (strain A846/88) GLKDFNDGALAMRNVEWIGETAWKWAHRLLDWIRGKAKTDPQAKLADVHDEIMLHYSDSILALGSEKLPIDHITKSISRCRELVSIAQEAKSGPHSSFLNQAIKNYTLAISQHRKCQTGPRPEPVVVYLYGPPGTGKSLLASLLAQTLSQRLAGTPDDVYSPSSASCEYFDGYTGQTVHFIDDIGQDPEGRDWANFPNLVSSAPFIVPMASLEEKGTHYTSKVIVVTSNFHEPNERAARSMGALRRRVHLRINVTSNGVPFDPTNALNPIPGTQSKYFTAQTPLTLFQSNTVRLDRDSIWTPTFTNMDELVDAIVTRLDRSTGVSNSLASLIRRQ 1318 1652 9960DF0B342DB151 o91464-acbd3 5 3A 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3a 3A polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ACBD3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association nfa mint o91464-acbd3-1 4 2BC 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 3AB 3AB polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1a f2b f2d acbd3-o91464 4 3A 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3ab 3AB polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1a f2b f2d acbd3-o91464-1 4 ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 2C 14 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1a f2b f2d o91464-acbd3-2 4 2C 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association mint f1a f2b f2d acbd3-o91464-2 4 ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2B 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1a f2b f2d pi4kb-acbd3 4 ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI4KB 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint f6a f6c acbd3-o91464-3 4 3AB 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2bc 2BC polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ACBD3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f1a f2b f2d o91464-acbd3-3 1 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2C 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-pro_0000448012-1 1 2C 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint o91464-acbd3-4 1 3A 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 3AB 3AB polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-o91464-5 1 3A 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 2BC 2BC polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-o91464-6 1 2B 14 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint o91464-acbd3-5 1 2B 14 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-pi4kb 1 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI4KB 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b homomint mint pi4kb-acbd3-1 1 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI4KB 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b homomint mint o91464-acbd3-6 1 2BC 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-o91464-7 1 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2BC 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint acbd3-o91464-8 1 3AB 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 3AB 3AB polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint o91464-acbd3-7 1 3AB 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2BC 2BC polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1b mint o91464-acbd3-8 2 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2B 10 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1c mint o91464-acbd3-9 2 ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2C 9 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1c mint o91464-acbd3-10 2 3A 14 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1c mint o91464-acbd3-11 2 3AB 8 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified 3ab 3AB polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1c mint acbd3-golgb1 3 giantin 12 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell ACBD3 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4a mint the sequence for giantin in Cercopithecus aethiops is not available so we used the UniprotID of rat protein because of the antibody used to immunoprecipitate giantin is developed against the rat sequence. the sequence for ABCD3 in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate ABCD3 is developed against the human sequence. acbd3-golga2 3 GM130 6 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell ACBD3 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4b mint the sequence for GM130 in Cercopithecus aethiops is not available so we used the UniprotID of rat protein because of the antibody used to immunoprecipitate GM130 is developed against the rat sequence. the sequence for ABCD3 in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate ABCD3 is developed against the human sequence. acbd3-tgoln2 3 ACBD3 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell TGN46 13 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f4c homomint mint the sequence for TGN46 in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate TGN46 is developed against the human sequence. the sequence for ABCD3 in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate ABCD3 is developed against the human sequence. acbd3-pi4kb-1 3 PI4KB 11 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell ACBD3 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f7a homomint mint the sequence for PI4KB in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate PI4KB is developed against the human sequence. the sequence for ABCD3 in Cercopithecus aethiops is not available so we used the UniprotID of human protein because of the antibody used to immunoprecipitate ABCD3 is developed against the human sequence. pro_0000448012-acbd3-1 4 2C 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association mint f1a f2b f2d pro_0000448014-acbd3-1 4 2C 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ACBD3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association mint f1a f2b f2d