MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. Insights into ubiquitin-conjugating enzyme/ co-activator interactions from the structure of the Pex4p:Pex22p complex. EMBO J. (0261-4189) 2012 imex curation Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page weight by comassie molecular weight estimation by coomasie staining weight by comassie Williams C., van den Berg M., Panjikar S., Stanley WA., Distel B., Wilmanns M. c.williams@embl-hamburg.de EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation pex22_yeast Peroxisome assembly protein 22 YAL055W PEX22 Peroxin-22 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN 2D2E34BB93F756EF ubcx_yeast Ubiquitin-conjugating enzyme E2-21 kDa PEX4 PAS2 UBC10 Ubiquitin-protein ligase Ubiquitin carrier protein Peroxin-4 YGR133W E2 ubiquitin-conjugating enzyme PEX4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH D4E438B689F76CAD pex22-pex4-2 2 PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint Coordinates and structure factors heve been deposited in the Protein Data Bank with accession code 2y9m. f3 t2 f5 pex22-pex4-3 4 PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association st1 mint pex22-pex4-4 5 PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:21:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:43:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr172ala' Tue Jun 30 19:05:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr172Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 sf1 pex22-pex4-5 5 PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Phe mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:59:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:21:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr172phe' Tue Jun 30 18:57:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr172Phe' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 sf1 pex22-pex4-6 5 PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P39718:p.Lys133Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:48:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:46:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys133ala' Tue Jun 30 18:21:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys133Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 sf1 pex22-pex4-7 1 PEX22 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint sf5 st2 pex4-pex22-1 3 PEX4 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:18:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:07:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr172ala' Tue Jun 30 17:06:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr172Ala' PEX22 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7b mint pex22-pex4-8 6 PEX4 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P29340:p.Tyr172Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Tue Jul 12 10:55:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:08:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr172ala' Tue Jun 30 18:02:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr172Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX22 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f6a mint