MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it CD8αα and -αβ isotypes are equally recruited to the immunological synapse through their ability to bind to MHC class I. CD8αα and -αβ isotypes are equally recruited to the immunological synapse through their ability to bind to MHC class I. EMBO Rep. (1469-221X) 2011 imex curation Rybakin V., Clamme JP., Ampudia J., Yachi PP., Gascoigne NR. Only protein-protein interactions mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Rybakin V., Clamme JP., Ampudia J., Yachi PP., Gascoigne NR. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation cd8b_mouse T-cell surface glycoprotein CD8 beta chain Cd8b Cd8b1 Ly-3 Lymphocyte antigen 3 Lyt-3 Lyt3 T-cell membrane glycoprotein Ly-3 T-cell surface glycoprotein Lyt-3 protein protein mouse Mus musculus Mouse MQPWLWLVFSMKLAALWSSSALIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQDPKDKYFEFLASWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPKMVFGTGTKLTVVDVLPTTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTTLSLLVVCILLLLAFLGVAVYFYCVRRRARIHFMKQFHK mint 138D2DCA43215BDB cd8a_mouse T-cell surface glycoprotein CD8 alpha chain Cd8a Lyt-2 Lyt2 T-cell surface glycoprotein Lyt-2 protein protein mouse Mus musculus Mouse MASPLTRFLSLNLLLLGESIILGSGEAKPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIYIWAPLAGICVALLLSLIITLICYHRSRKRVCKCPRPLVRQEGKPRPSEKIV 22D0D78ECEC3EA04 cd8a-cd8a 1 Cd8a 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cd8a 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1 homomint mint cd8a-cd8b 1 Cd8b 2 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cd8a 3 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1 mint