I2D I2D Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Oncogene (0950-9232) 2011 imex curation Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Accepted 2012-MAY-25 by MGT 20-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Oncogene (0950-9232) 2011 imex curation Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Accepted 2012-MAY-25 by MGT Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Twist contributes to hormone resistance in breast cancer by downregulating estrogen receptor-α Oncogene (0950-9232) 2011 imex curation Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Vesuna F., Lisok A., Kimble B., Domek J., Kato Y., van der Groep P., Artemov D., Kowalski J., Carraway H., van Diest P., Raman V. Cancer - Interactions investigated in the context of cancer vraman2@jhmi.edu, fvesuna1@jhmi.edu Accepted 2012-MAY-25 by MGT 20-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2011 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 twst1_human Twist-related protein 1 H-twist TWIST1 TWIST BHLHA38 Class A basic helix-loop-helix protein 38 protein protein human Homo sapiens Human MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGVGGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH DIP protein Q15672 original sequence version: 156 DIP protein Q15672 original sequence version: 159 9394E4351BA1D081 dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE DIP protein Q9UBC3 original sequence version: 148 DIP protein Q9UBC3 original sequence version: 83 F20A67CF78951532 eralpha_human_gene Human estrogen receptor alpha gene gene human Homo sapiens Human dnmt3b-hdac1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 5i eralpha-twist1 1 7 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 1e eralpha-twist1-1 3 7 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association 1f hdac1-eralpha 3 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5m dnmt3b-eralpha-2 3 7 unspecified role unspecified role prey prey promoter-e_boxes binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait association association 5m