MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it MYST protein acetyltransferase activity requires active site lysine autoacetylation. MYST protein acetyltransferase activity requires active site lysine autoacetylation. EMBO J. (0261-4189) 2012 imex curation Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation MYST protein acetyltransferase activity requires active site lysine autoacetylation. MYST protein acetyltransferase activity requires active site lysine autoacetylation. EMBO J. (0261-4189) 2012 imex curation Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation MYST protein acetyltransferase activity requires active site lysine autoacetylation. MYST protein acetyltransferase activity requires active site lysine autoacetylation. EMBO J. (0261-4189) 2012 imex curation Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 69B7D1F89E62DE41 esa1_yeast Histone acetyltransferase ESA1 ESA1 O5257 YOR244W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGVDGFSRENTDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPVFTASQLRFAW 9E970F744D0B9E18 9E970F744D0B9E18 kat8_human Histone acetyltransferase KAT8 KAT8 MOF PP7073 MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1 MYST1 Lysine acetyltransferase 8 protein protein human Homo sapiens Human MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK 66C474BE5B90E8E3 hst2_yeast NAD-dependent protein deacetylase HST2 HST2 Homologous to SIR2 protein 2 Regulatory protein SIR2 homolog 2 LPA2C YPL015C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTAQGGMGDNSKEQLLEIVHDLENLSLDQSEHESADKKDKKLQRLNGHDSDEDGASNSSSSQKAAKE ED281E5B8241A4D0 esa1-hhf1 3 ESA1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint t1 f1a Coordinates and structure factors heve been deposited in the Protein Data Bank with accession code 3TO6. esa1-hst2 1 HST2 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified ESA1 5 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain acetylated residue acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain prerequisite-ptm deacetylation deacetylation reaction deacetylation homomint mint t2 f1f hst2-kat8 1 MOF 6 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified acetylated residue acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain HST2 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified deacetylation deacetylation reaction deacetylation homomint mint t2 f1f esa1-hhf1-1 2 ESA1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q08649:p.Lys262Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:20:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:42:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys262arg' Tue Jun 30 15:55:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys262Arg' H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain acetylation acetylation reaction acetylation f2b mint hhf1-kat8 2 H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain MOF 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9H7Z6:p.Lys274Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:20:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:26:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys274arg' Tue Jun 30 19:54:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys274Arg' acetylation acetylation reaction acetylation f2b mint esa1-hhf1-2 2 H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ESA1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q08649:p.Lys262Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:58:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:24:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys262ala' Tue Jun 30 17:51:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys262Ala' acetylation acetylation reaction acetylation sf3 mint esa1-hhf1-3 2 ESA1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q08649:p.Lys262Gln mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K Q Tue Jul 12 10:58:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:33:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys262gln' Tue Jun 30 17:23:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys262Gln' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain acetylation acetylation reaction acetylation sf3 mint hhf1-kat8-1 2 MOF 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9H7Z6:p.Lys274Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Tue Jul 12 10:22:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:11:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys274ala' Tue Jun 30 17:09:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys274Ala' H4 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain acetylation acetylation reaction acetylation sf3 mint