IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MutL associates with Escherichia coli RecA and inhibits its ATPase activity. MutL associates with Escherichia coli RecA and inhibits its ATPase activity. Arch. Biochem. Biophys. (0003-9861) 2012 imex curation Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Arch. Biochem. Biophys. (0003-9861) 2012 Only protein-protein interactions imex curation MutL associates with Escherichia coli RecA and inhibits its ATPase activity. MutL associates with Escherichia coli RecA and inhibits its ATPase activity. Arch. Biochem. Biophys. (0003-9861) 2012 imex curation Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Arch. Biochem. Biophys. (0003-9861) 2012 Only protein-protein interactions imex curation MutL associates with Escherichia coli RecA and inhibits its ATPase activity. MutL associates with Escherichia coli RecA and inhibits its ATPase activity. Arch. Biochem. Biophys. (0003-9861) 2012 imex curation Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag enzyme assay tag visualisation by enzyme assay tag enzyme assay Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Arch. Biochem. Biophys. (0003-9861) 2012 Only protein-protein interactions imex curation MutL associates with Escherichia coli RecA and inhibits its ATPase activity. MutL associates with Escherichia coli RecA and inhibits its ATPase activity. Arch. Biochem. Biophys. (0003-9861) 2012 imex curation Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis predetermined predetermined participant predetermined Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. They used capillary electrophoresis Arch. Biochem. Biophys. (0003-9861) 2012 Only protein-protein interactions imex curation MutL associates with Escherichia coli RecA and inhibits its ATPase activity. MutL associates with Escherichia coli RecA and inhibits its ATPase activity. Arch. Biochem. Biophys. (0003-9861) 2012 imex curation Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhang M., Zhou Y., Li T., Wang H., Cheng F., Zhou Y., Bi L., Zhang X.E. blj@sun5.ibp.ac.cn, x.zhang@wh.iov.cn Accepted 2012-NOV-19 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Arch. Biochem. Biophys. (0003-9861) 2012 Only protein-protein interactions imex curation reca_ecoli Protein RecA recA lexB recH rnmB umuB tif zab b2699 Recombinase A JW2669 protein protein ecoli Escherichia coli (strain K12) MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSTPDFSVDDSEGVAETNEDF DIP protein P0A7G6 original sequence version: 97 DIP protein P0A7G6 original sequence version: 52 DIP protein P0A7G6 original sequence version: 68 866EF8F83BE32A36 90mer_polyt single-stranded biotinylated 90mer-polyT ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) mutl_ecoli DNA mismatch repair protein MutL mutL b4170 JW4128 protein protein ecoli Escherichia coli (strain K12) MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAPRSIPENRVAAGRNHFAEPAAREPVAPRYTPAPASGSRPAAPWPNAQPGYQKQQGEVYRQLLQTPAPMQKLKAPEPQEPALAANSQSFGRVLTIVHSDCALLERDGNISLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSALEKAQSALAELGIDFQSDAQHVTIRAVPLPLRQQNLQILIPELIGYLAKQSVFEPGNIAQWIARNLMSEHAQWSMAQAITLLADVERLCPQLVKTPPGGLLQSVDLHPAIKALKDE DIP protein P23367 original sequence version: 102 DIP protein P23367 original sequence version: null C69D2735BF5FA165 m13mp18 M13mp18ssDNA ss dna single stranded deoxyribonucleic acid ss DNA ss dna ecoli Escherichia coli (strain K12) ssb_ecoli Single-stranded DNA-binding protein Helix-destabilizing protein ssb exrB lexC b4059 JW4020 protein protein ecoli Escherichia coli (strain K12) MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF DIP protein P0AGE0 original sequence version: 44 F0AF43B6DC8D02FC atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) reca-mutl 3 6 unspecified role unspecified role bait bait nucl transformation nucleic acid transformation nucl transformation histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sbp sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1A reca-mutl-1 2 6 unspecified role unspecified role bait bait nucl transformation nucleic acid transformation nucl transformation gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 1B 90mer-reca-2 4 7 unspecified role unspecified role neutral component neutral component tmr fluorophore fluorophore undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3 adenosine-m13mp18-3 1 9 ancillary ancillary unspecified role unspecified role 11 enzyme target enzyme target substrate substrate unspecified role unspecified role 10 ancillary ancillary unspecified role unspecified role ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Figure 4 adenosine-m13mp18-2 1 10 ancillary ancillary unspecified role unspecified role 11 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 ancillary ancillary unspecified role unspecified role 8 enzyme enzyme unspecified role unspecified role P23367:p.Glu29Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:38:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu29ala' Tue Jun 30 19:02:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu29Ala' histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) atpase reaction atpase reaction Figure 4 adenosine-m13mp18-1 1 10 ancillary ancillary unspecified role unspecified role 8 inhibitor inhibitor unspecified role unspecified role histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 enzyme target enzyme target substrate substrate unspecified role unspecified role 6 enzyme enzyme unspecified role unspecified role histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 ancillary ancillary unspecified role unspecified role atpase reaction atpase reaction Figure 4 To verify whether it was the ATPase activity of RecA which was inhibited by MutL, the MutL mutant L-E29A, which is completely inactive in ATP hydrolysis but still has a physical interaction with RecA was added to the reaction system. As was the case with wild type MutL, L-E29A also had an inhibitory effect on RecA’s ATPase activity. mutl-reca 5 6 unspecified role unspecified role unspecified role unspecified role histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role unspecified role unspecified role histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction supplemental Fig. S1 90mer-mutl-1 5 8 unspecified role unspecified role prey prey histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait direct interaction direct interaction Figure 2 90mer-mutl-2 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2A