InnateDB InnateDB A motif in the V3 domain of the kinase PKC-θ determines its localization in the immunological synapse and functions in T cells via association with CD28. A motif in the V3 domain of the kinase PKC-θ determines its localization in the immunological synapse and functions in T cells via association with CD28. Nat. Immunol. (1529-2908) 2011 imex curation Kong K.F., Yokosuka T., Canonigo-Balancio A.J., Isakov N., Saito T., Altman A. CD4+ T cells derived from Prkcq-/- mice amnon@liai.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-jurkat Homo sapiens jurkat Human T cell leukemia anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kong K.F., Yokosuka T., Canonigo-Balancio A.J., Isakov N., Saito T., Altman A. CD4+ T cells derived from Prkcq-/- mice species information of complemented Lck was determined from author correspondence amnon@liai.org Accepted 2012-NOV-16 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity A motif in the V3 domain of the kinase PKC-θ determines its localization in the immunological synapse and functions in T cells via association with CD28. A motif in the V3 domain of the kinase PKC-θ determines its localization in the immunological synapse and functions in T cells via association with CD28. Nat. Immunol. (1529-2908) 2011 imex curation Kong K.F., Yokosuka T., Canonigo-Balancio A.J., Isakov N., Saito T., Altman A. CD4+ T cells derived from Prkcq-/- mice amnon@liai.org 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kong K.F., Yokosuka T., Canonigo-Balancio A.J., Isakov N., Saito T., Altman A. CD4+ T cells derived from Prkcq-/- mice amnon@liai.org Accepted 2012-NOV-16 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity cd28_human T-cell-specific surface glycoprotein CD28 CD28 TP44 protein protein human Homo sapiens Human MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS 1D9B6552A5878D0F kpct_human Protein kinase C theta type PRKCQ nPKC-theta PRKCT protein protein human Homo sapiens Human MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS B3C53AB892D5210A lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D cd28_mouse T-cell-specific surface glycoprotein CD28 Cd28 protein protein mouse Mus musculus Mouse MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP DIP protein P31041 original sequence version: 115 C8E1339DD7E53CA6 cd28-prkcq 2 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range v3 egion sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V3 domain 6 unspecified role unspecified role bait bait physical association physical association Fig. 2A prkcq-cd28 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey P06239:p.Arg154Lys mutation mutation certain certain sequence position certain certain certain sequence position certain R K Wed May 02 19:46:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg154lys' Tue Jun 30 19:28:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg154Lys' P06239:p.Trp97Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 17:11:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp97ala' Tue Jun 30 18:48:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp97Ala' P06239:p.[Trp97Ala;Arg154Lys] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain R K Wed May 02 14:45:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp97ala,arg154lys' Tue Jun 30 17:25:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp97Ala;Arg154Lys]' 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V3 domain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 5 prkcq-cd28-1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain V3 domain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey P06239:p.Arg154Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R K Wed May 02 18:20:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg154lys' Tue Jun 30 18:15:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg154Lys' physical association physical association Fig. 5