MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. EMBO J. (0261-4189) 2011 imex curation Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down predetermined predetermined participant predetermined Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. EMBO J. (0261-4189) 2011 imex curation Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. EMBO J. (0261-4189) 2011 imex curation Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. EMBO J. (0261-4189) 2011 imex curation Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. NYAP: a phosphoprotein family that links PI3K to WAVE1 signalling in neurons. EMBO J. (0261-4189) 2011 imex curation Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yokoyama K., Tezuka T., Kotani M., Nakazawa T., Hoshina N., Shimoda Y., Kakuta S., Sudo K., Watanabe K., Iwakura Y., Yamamoto T. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation wasf1_mouse Wiskott-Aldrich syndrome protein family member 1 Protein WAVE-1 Wasf1 Wave1 protein protein mouse Mus musculus Mouse MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDADLLHKHIEVANGPASHYETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPTPTCISSATGLIENRPQSPAAGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVAVAALAHPPSGLHPAPSTAPGPHAPLMPPSPPSQVLPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE 8746910987D80D16 nyap2_mouse Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2 Nyap2 Kiaa1486 protein protein mouse Mus musculus Mouse MIPSKMMSANPEEDPLDTFFQYIEDMGMKAYDGLVIQNASDIARENDRLRNETKLAYLKEKNEKRRRQEETIKRIGGEVGRGQDASYAGKHFRMGFMTMPAPQDRLPHPCSSGFTVRSQSLHSVGGTEDDSSCGSRRQPPPKPKRDPSTKLSTSSETVNSTAASKSGRSLERAEGKFTVPASHSPPRASTSGHLFPSPGSQERNIKVSAKPRPHSDEYSKKIPPPKPKRNPNTQLSTSFDETYIKKHVPRRTSLPRDSSLSQVCSPAADPEEEEPVYIEMVGNILRDFRKEEDDQSEAVYEEMKYPIFDDLGHDSKCDFDHHSCSSQCATPTVPDLDFVKSSGPCTPKGLLCDIPPPFPNLLSHRPPLLVFPPAPVHCSPNSDESPLTPLEVTKLPVLENVSYMKQPPGACPSSLPSHGSSHAKDQTGALGPAPGASILSSSPPPPSTLYRTQSPHGYPKSHSTSPSPVSMGRSLTPLSLKRPPPYDAVHSGSLSRSSSSVPHTTPRPVSQDGAKMVNAAVNTYSAAQSGSRSRTPTSPLEELTSLFTSGRSLLRKSSSGRRSKEPAEKSTEELKVRSHSTEPLPKLDSKERGHYGSSSSREPVKAQEWDGTPGPPVVTSRMGRCSVSPTLLAGNHSSEPKVSCKLGRSASTSGVPPPSVTPLRQASDLQQSQVPSSLANRD mint 76FDE6609FFDAC8F acot9_human Acyl-coenzyme A thioesterase 9, mitochondrial ACOT9 Acyl-CoA thioester hydrolase 9 CGI-16 protein protein human Homo sapiens Human MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWMENSKLKSLEICHPQERNIFNRIFGGFLMRKAYELAWATACSFGGSRPFVVAVDDIMFQKPVEVGSLLFLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVFPKTYGESMLYLDGQRHFNSMSGPATLRKDYLVEP 1CE2158D4F83D4D6 wasf1_human Wiskott-Aldrich syndrome protein family member 1 WASF1 KIAA0269 SCAR1 WAVE1 Protein WAVE-1 Verprolin homology domain-containing protein 1 protein protein human Homo sapiens Human MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE DIP protein Q92558 original sequence version: 78 DIP protein Q92558 original sequence version: 82 DIP protein Q92558 original sequence version: 124 DIP protein Q92558 original sequence version: 87 44B4527BDB77BC6E nckp1_mouse Nck-associated protein 1 p125Nap1 Membrane-associated protein HEM-2 Brain protein H19 MH19 Nckap1 Hem2 Kiaa0587 Nap1 protein protein mouse Mus musculus Mouse MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVFFDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA 279246384B0F4B77 rhg26_human Rho GTPase-activating protein 26 ARHGAP26 GRAF KIAA0621 OPHN1L Rho-type GTPase-activating protein 26 Oligophrenin-1-like protein GTPase regulator associated with focal adhesion kinase protein protein human Homo sapiens Human MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFRKEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRVQKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPVRSVAGFVWFSVAAVVLSLARSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL 5C81DBDECB32B18A p85a_mouse Phosphatidylinositol 3-kinase regulatory subunit alpha Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha Pik3r1 protein protein mouse Mus musculus Mouse MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEDIGWLNGYNETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQALPLPDLAEQFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVHVLADAFKRYLADLPNPVIPVAVYNEMMSLAQELQSPEDCIQLLKKLIRLPNIPHQCWLTLQYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNERQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR DIP protein P26450 original sequence version: 149 DIP protein P26450 original sequence version: 142 DIP protein P26450 original sequence version: 140 9975D7AD8BABBA9C nckp1_human Nck-associated protein 1 NCKAP1 HEM2 KIAA0587 NAP1 p125Nap1 Membrane-associated protein HEM-2 protein protein human Homo sapiens Human MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFIVRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTMLNPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEVFHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEVFDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCNMFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKPGVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHGEPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSPAIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRNRESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA DIP protein Q9Y2A7 original sequence version: 81 DIP protein Q9Y2A7-1 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 85 DIP protein Q9Y2A7 original sequence version: 129 12D32BAC7080CB5A cyfp1_mouse Cytoplasmic FMR1-interacting protein 1 Cyfip1 Shyc Kiaa0068 Sra1 Specifically Rac1-associated protein 1 protein protein mouse Mus musculus Mouse MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCASSSSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDNAEEYERATRYNYTTEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTKFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSVVELDGLLEINRMTHKLLSRYLTLDSFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAVLFCLLIEQSLSLEEVCDLLHAAPFQNILPRIHVKEGERVDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRTFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGESTPVEHVRCFQPPIHQSLASS 793986FB417CF19B myo16_human Unconventional myosin-XVI MYO16 KIAA0865 Unconventional myosin-16 MYO16B NYAP3 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3 protein protein human Homo sapiens Human MEIDQCLLESLPLGQRQRLVKRMRCEQIKAYYEREKAFQKQEGFLKRLKHAKNPKVHFNLTDMLQDAIIHHNDKEVLRLLKEGADPHTLVSSGGSLLHLCARYDNAFIAEILIDRGVNVNHQDEDFWTPMHIACACDNPDIVLLLVLAGANVLLQDVNGNIPLDYAVEGTESSSILLTYLDENGVDLTSLRQMKLQRPMSMLTDVKHFLSSGGNVNEKNDEGVTLLHMACASGYKEVVSLILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQANPHLVNCNEEKASDIAASEFIEEMLLKAEIAWEEKMKEPLSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEKDIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATLSELNDGSLLYEIQKRFGNNQIYTFIGDILLLVNPYKELPIYSSMVSQLYFSSSGKLCSSLPPHLFSCVERAFHQLFREQRPQCFILSGERGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFGHAKTTLNDLSSCFIKYFELQFCERKQQLTGARIYTYLLEKSRLVSQPLGQSNFLIFYLLMDGLSAEEKYGLHLNNLCAHRYLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVENLFVILAAILHLGDIRFTALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQYFKGDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKSMQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHYINEVLFLHEQVECVQEGVTMETAYSPGNQNGVLDFFFQKPSGFLTLLDEESQMIWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMYDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQSKLSQTGSLVSAYPSFKFRGHKSALLSKKMTASSIIGENKNYLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLMDIIGKLQKCTPHFIHCIRPNNSKLPDTFDNFYVSAQLQYIGVLEMVKIFRYGYPVRLSFSDFLSRYKPLADTFLREKKEQSAAERCRLVLQQCKLQGWQMGVRKVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQNTEDMGLKTYDALVIQNASDIARENDRLRSEMNAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSLHSVFSMDDSSSLPSPRKQPPPKPKRDPNTRLSASYEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLALFNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPYSPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNANNHGIQLSNSLSSAITAENGNSISNGLPEEDGYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQILHHAEPRVPPPPPCKKPSLLKKPEGASCNRLPSELWDTTI B2D821DD53BD109E myo16_mouse Unconventional myosin-XVI Myo16 Kiaa0865 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3 Nyap3 Unconventional myosin-16 protein protein mouse Mus musculus Mouse MEIDQCLLESLPLGQRQRLVKRMRCEQIKAYYEREKVFQKQEGPLKRSKPGKRQKVRFGLADMIQDAVIHHHDKEVLQLLKEGADPHTLVSSGGSLLHLCARYDNVFIAEVLIDRGVNVNHQDEDFWTPMHIACACDNPDIVLLLILAGANVFLQDVNGNIPLDYAVEGTESSAILLAYLDEKGVDLSSLRQIKLQRPLSMLTDVRHFLSSGGDVNEKNDDGVTLLHMACASGYKEVVLLLLEHGGDLNGTDDRYWTPLHLAAKYGQTTLVKLLLAHQANPHLVNCNGEKPSDIAASESIEEMLLKAEIAWEEKMKESPSAPSLAQEELYEILHDLPDLSSKLSPLVLPIAKQDSLLEKDIMFKDTTKGLCKQESQDGPPETSMTSNCGKPEQVQVMPPAPSDDLATLSELNDSSLLYEIQKRFGNDQIHTFIGDIFLLVNPFKELPIYSTMVSQMYLSPTGQRSPSLPPHLFSCAERAFHRLFQERKPQNIILSGERGSGKTQASKQIMKYLTSRASSSCTMFDSRLRHAIYIVEAFGHAKTTLNNVSSCLIQYWELQCCQRRKHITGARISTYMLEKSRVVAQPPGQGTFLIFSWLMDGLSSEEKCGLHLNNFCAHRYVSQGMREDVSTAEHSLNKERLAALKHALNVIGFSTLEVENLFVILSAILHIGDIQFTALTEADSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQYFKGDVIIRRHTIQMAAFYRDLLAKSLYSRLFGFLINTVNCCLQNQDEYKSLQTLDIGILDIFGFEEFQKNEFEQLCVNLTNEKMHHYIQEVLFLQEQTECVQEGVAMETACSPGNQAGVLDFFFQKPSGFFSLLDEESQVIWSGEPNLPRKLQGLLESSNTNAVYSPVKDGNGNVAFKGQGAAFTVMHYAGRVMYEMGGAVERNKDSLSQNLLFVMKTSENVVISHLFQSKLSQTGSLISSYPSFKFGGHKSTLLSKRTASSMVGVNKNYLELSKLLKKKGTSTFLQRLERGEPATAASQLTKSLADITAKLQRGSPHFILCIKPNTSQLPGVFDHFYVSAQLQYLGVLGLVRLFRSGYPVRPSFEDFLSRYEPLASVLLGETKGQAAEERCRLVLQRCKLQGWQIGVHKVFLKYWHVDQLSDLWLQLQRKIVTCQKVIRGFLARQHLLQRMSIKQQEVTSIKSFLQSTEDMALKTYDALVIQNASDIAREHDRLRKEVHTAYHRNRQEEGTKRAEDQGGCRHVHSNSVPVPMVVDSLAQALTGPSTRPPSLHSVFSMDDSTGLPSPRKQPPPKPKRDPNTRLSASYEAVSACLSAAKDAAGEALTRPRPHSDDYSTMKKIPPRKPKRSPHTKLSGSYEEIWGPPRPSGTMGQGGRHQAPGTLSVQWARPDSVPQCTPQLPLHLPLPQGDYDDDAEPVYIEMVGNAARAGGSETDSPDQGESVYEEMKYILPEEGCGLGMLTFLPASPPLFLETRKAIILEAAEGNCQPSKDTCDIPPPFPNLLPHRPPLLVFPPTPVTRSPASDESPLTPLEVKKLPVLETNLKYPVQSEGSSPLSPQYSKAQKGDNDQLASPGFPVFNGPSRISPPATPPPPPGPPPAPCGPPPAPCGPPPAPCGPPPAPCGPPPAPCGPPPAPCGAASASCGVAPAPCRPPTHFAFPPESVLVTAAKALTNSDLPRTQPKPSSAPVPGPCSSFVKAPYSPGKTARADLRKTSSTFSPPSPYSPPNSRPLSSPLDELASLFNSGRSVLRRSAVGRRIREAEGFETNMNLSSRDEPSSSEMASETQDRNANNHGTQLSSSLSSDVTAENGNPVTNGLAEDDGCSRLCLSGMGTSSFQRNRESHTTQVIHQLRLSENESVALQELLDWRRKLCEAREGWQEALQHPEPRAPPPPPCKKPTLLKKPEGGSCTRLPSQLWDSSM mint 9F3899BB2035BD48 cyfp1_human Cytoplasmic FMR1-interacting protein 1 Specifically Rac1-associated protein 1 p140sra-1 CYFIP1 KIAA0068 protein protein human Homo sapiens Human MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYIEQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVTKLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLADIVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFKQLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFISELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPTDKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTVYAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESFFYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASMMEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGSLLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRITLHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSSIYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKICRLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVCDLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCIPVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS DIP protein Q7L576 original sequence version: 55 DIP protein Q7L576-1 original sequence version: 59 DIP protein Q7L576 original sequence version: 59 DIP protein Q7L576 original sequence version: 100 D8F45E13207BEF16 rhg26_mouse Rho GTPase-activating protein 26 Kiaa0621 Rho-type GTPase-activating protein 26 Arhgap26 protein protein mouse Mus musculus Mouse MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKFADSLNEFKFQCIGDAETDDEMCIARSLQEFAAVLRNLEDERSRMIENASEVLITPLEKFRKEQIGAAREAKKKYDKETEKYCGTLEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKTQLTISIQNTRNRFEGTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITMVPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLWMEAMDGREPVYNSNRDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRVQKLLSVLMDPKAASETETDICAEWEIKTVTSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQETRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSKRPLTLFHAVPSTEKQEQRNSIINSSLESVSSSANSILNSSSSLQPNLNSSDSNLDVVKPSRPSSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVVLSLAWSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVREDSSTPFRKAKALYACQAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL fragmentation type: fragment mint B1BA51634549C891 p85a_human Phosphatidylinositol 3-kinase regulatory subunit alpha PIK3R1 GRB1 Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha protein protein human Homo sapiens Human MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVHVLADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEIIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR DIP protein P27986 original sequence version: 181 DIP protein P27986 original sequence version: 184 DIP protein P27986-1 original sequence version: 135 DIP protein P27986 original sequence version: 135 DIP protein P27986-1 original sequence version: 145 DIP protein P27986-1 original sequence version: 147 DIP protein P27986 original sequence version: 191 B9DAD8416C33140F acot9_mouse Acyl-coenzyme A thioesterase 9, mitochondrial Acot9 Acate2 Protein U8 Acyl-CoA thioester hydrolase 9 Acyl coenzyme A thioester hydrolase 2 Mitochondrial 48 kDa acyl-CoA thioester hydrolase 1 p48 protein protein mouse Mus musculus Mouse MKRAAIRLWTLNKGLLTHGRGLSQGSQYKISEPLHIHQVRDKLREIVGVSTVWRDHVKAMEERKLLHSFLPKSQKVLPPRKMRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTKMSPLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTSMEVKMKMFQLHNDEKYWPVLDATFVMVARDSENKGPAFVNPLIPENKEEEELFKQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLTTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQDNYIQVRVHSEVSSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP mint Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs 309CD950D85ACBD0 q8bm65-4 Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2 Nyap2 Kiaa1486 protein protein mouse Mus musculus Mouse MIPSKMMSANPEEDPLDTFFQYIEDMGMKAYDGLVIQNASDIARENDRLRNETKLAYLKEKNEKRRRQEETIKRIGGEVGRGQDASYAGKHFRMGFMTMPAPQDRLPHPCSSGFTVRSQSLHSVGGTEDDSSCGSRRQPPPKPKRDPSTKLSTSSETVNSTAASKSGRSLERAEGKFTVPASHSPPRASTSGHLFPSPGSQERNIKVSAKPRPHSDEYSKKIPPPKPKRNPNTQLSTSFDETYIKKHVPRRTSLPRDSSLSQVCSPAADPEEEEPVYIEMVGNILRDFRKEEDDQSEAVYEEMKYPIFDDLGHDSKCDFDHHSCSSQCATPTVPDLDFVKSSGPCTPKGLLCDIPPPFPNLLSHRPPLLVFPPAPVHCSPNSDESPLTPLEVTKLPVLENVSYMKQPPGACPSSLPSHGSSHAKDQTGALGPAPGASILSSSPPPPSTLYRTQSPHGYPKSHSTSPSPVSMGRSLTPLSLKRPPPYDAVHSGSLSRSSSSVPHTTPRPVSQDGAKMVNAAVNTYSAAQSGSRSRTPTSPLEELTSLFTSGRSLLRKSSSGRRSKEPAEKSTEELKVRSHSTEPLPKLDSKERGHYGSSSSREPVKAQEWDGTPGPPVVTSRMGRCSVSPTLLAGNHSSEPKVSCKLGRSASTSGVPPPSVTPLRQASDLQQSQVACMQWFHGDHTMLEMIEKKRCLCKEIKARQKTEKGLCKQDSMPILPSWKKNAGAKKYSPPPYSKQQTVFWDTAI mint 4FB8D1013AB6977A nyap1_mouse Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1 Nyap1 protein protein mouse Mus musculus Mouse MNLLYRKTKLEWRQHKEEEAKRSSSKEAAPTGPVGPGAVPGPGVRVRDIASLRRSLRMGFMTMPASQEHTPHPCRSTMAPRSLSCHSVGSMDSVGGGPGGGLTEDSSTRRPPAKPRRHPSTKLSMAGPGAETPPSKKAGSQKPAPECRESSRKVPPQKPRRSPNTQLSVSFDESCAPAPSPRGANLPLQRLSRASRITGDLDAGAQEEEPVYIEMVGDVFRGGGRSGGGLAGPPLGSGGPTPPAAADSDSEDSEAIYEEMKYPLPEEAGDGRANGPPPLTAPSPPQQTHILQPHPHPHRRPASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQAKSASRAPGDGVSRLPVLCHSKEPAGSTPAPQVPARERETPPLPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQTRGERELPNSHSMICPKAAGVPAAHPAPAALLPGPPKDKAVSYTMVYSAVKVTTHSVLPAGPPLGVGEPKTEEISVLHGMLCASSRPPVPGKSSPHSGAMGSAAGVLHHRSCLASPHSLPDPTGGSLTPLWTYPATAAGLKRPPAYDSLKAGGVLNKGCGMGAPSPMVKIQLQEQGTDGGAFASISCAHVIASAGTPEEEEEMGAAFGAGWALQRKVLYGGRKAKEVDTEEDGARAWNGSTEGPGKVEHEDRGPVPSGIPVRSQGAEGLLARIHHDRGGSRTALPVPCQTFPACHRNGDFTGGYRLGRSASTSGVRQAALHTPRPCSQPRDALSQTHPVLPLPLPPQPARERDGKLLEVIERKRCVCKEIKARHRPDRGLCKQESMPILPSWRRVPEPRKSGTPPCRRQHTVLWDTAI mint 3BC67410155550AA nyap1-pik3r1 3 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q6PFX7:p.Tyr212Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:53:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:58:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr212phe' Tue Jun 30 18:42:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr212Phe' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6PFX7:p.Tyr257Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:53:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:16:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr257phe' Tue Jun 30 17:15:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr257Phe' PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4a mint nyap1-pik3r1-1 3 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6PFX7:p.Tyr212Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:13:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:52:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr212phe' Tue Jun 30 17:47:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr212Phe' PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4a mint nyap1-pik3r1-2 3 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q6PFX7:p.Tyr257Phe mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:53:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:06:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr257phe' Tue Jun 30 16:20:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr257Phe' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4a mint nyap2-pik3r1 3 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q8BM65-4:p.Tyr300Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:11:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:58:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr300phe' Tue Jun 30 16:04:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr300Phe' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8BM65-4:p.Tyr277Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:11:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:24:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277phe' Tue Jun 30 16:23:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Phe' PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4b mint nyap2-pik3r1-1 3 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q8BM65-4:p.Tyr277Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Tue Jul 12 10:51:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:49:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr277phe' Tue Jun 30 16:42:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr277Phe' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4b mint myo16-pik3r1 3 NYAP3 15 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:06:24 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Tyr1441Phe flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:05:02 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Tyr1416Phe PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association f4c homomint mint nyap1-nckap1 3 Nap1 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7a nyap2-nckap1 3 Nap1 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7a myo16-nckap1 3 Nap1 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP3 15 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf7a nyap1-cyfip1 3 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sra1 17 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7b nyap2-cyfip1 3 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sra1 17 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7b myo16-cyfip1 3 Sra1 17 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP3 15 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf7b nyap1-arhgap26 3 GRAF 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7c nyap2-arhgap26 3 GRAF 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7c myo16-arhgap26 3 GRAF 11 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NYAP3 15 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf7c nyap1-acot9 3 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Acot9 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7d nyap2-acot9 3 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Acot9 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf7d myo16-acot9 3 NYAP3 15 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Acot9 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf7d nyap2-acot9-1 4 NYAP2 21 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GRAF 18 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Acot9 20 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Sra1 14 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association f6a mint wasf1-cyfip1 2 PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Sra1 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Wave1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f7a homomint mint In WT brains, PI3K p85a was present in the anit- WAVE1 immunoprecipitate, whereas this association completely disappeared in TKO brains (Figure 7A). Further, the association was absent in HEK293T cells and the CG4 oligodendrocyte cell line, none of which express the NYAPs (Figure 7A; WT livers, which do not express WAVE1, were examined as a negative control). pik3r1-cyfip1 2 Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Sra1 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f7b homomint mint wasf1-pik3r1 2 Wave1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f7c homomint mint nyap1-pik3r1-3 2 NYAP1 22 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4d mint nyap2-pik3r1-2 2 NYAP2 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4d mint myo16-pik3r1-1 2 NYAP3 16 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85 alpha 12 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4d mint nyap1-nckap1-1 2 NYAP1 22 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6b mint nyap2-nckap1-1 2 NYAP2 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6b mint myo16-nckap1-1 2 NYAP3 16 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4d mint wasf1-cyfip1-1 5 Nap1 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Sra1 17 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level WAVE1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f7a homomint mint In WT brains, PI3K p85a was present in the anit- WAVE1 immunoprecipitate, whereas this association completely disappeared in TKO brains (Figure 7A). Further, the association was absent in HEK293T cells and the CG4 oligodendrocyte cell line, none of which express the NYAPs (Figure 7A; WT livers, which do not express WAVE1, were examined as a negative control). wasf1-pik3r1-1 5 WAVE1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association homomint mint f7D Moreover, exogenous expression of NYAP1 in HEK293T cells resulted in the PI3K-WAVE1 association (Figure 7D) pik3r1-cyfip1-1 1 Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Sra1 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NYAP1 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain association association homomint f6D mint nyap2-cyfip1-1 1 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Sra1 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association mint f6E myo16-cyfip1-1 1 NYAP3 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sra1 14 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Nap1 10 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association homomint mint f6F nyap1-pik3r1-4 1 NYAP1 22 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf3 mint nyap2-pik3r1-3 1 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf3 mint myo16-pik3r1-2 1 NYAP3 16 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PI3K-p85alpha 19 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association sf3 mint nyap2-wasf1 1 NYAP2 21 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain WAVE1 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint sf8