mpidb The Microbial Protein Interaction Database The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. J. Bacteriol. (0021-9193) 2011 imex curation McManus H.R., Dove S.L. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot McManus H.R., Dove S.L. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. J. Bacteriol. (0021-9193) 2011 imex curation McManus H.R., Dove S.L. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined McManus H.R., Dove S.L. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation q9i1y8_pseae PAPS_reduct domain-containing protein PA2127 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MAGKHYQDADVHAATLSRLRLVFRNFERVCVAFSGGKDSSVTLQLALDVARELGRSPVDVLFIDLEGQYQATIDHVSEMLGRPDVRPWWVCLPLNLRNASSLEEPYWCCWEPGAEADWVRPLPKQRGVISDPAFFPFYRYRMEFEEFVAGFNAWLAREEPTAFLVGIRSDESLNRYLAVKRRSRAKQCAWTPPGGSAPLAWSARDRANPQAVSFFPIYDWRFEDLWRCVADHGYAYNRLYDQMYRAGVPFSQMRICQPYGDDQRKGLDLFHRIEPRTWFKVVRRVAGANYGARYCRQRFLGYRGGLGLPPSFGTWREYSQFLLRSMPPPLRGIYQRRIERFILWWKQHDYPLAIWPDAGIPALENRRKQPSWRRIALSLLKQDMARSLSFGFSQADIDRLVPGREKRS 87FD5B3B704643B1 q9i1y9_pseae ParB domain-containing protein PA2126 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MAQTKTLTERAEALFGELHGLPLAERIEAINRIRRLLHAHSPFAEEPVDCVQWVRAERVAGNDYNPNTVAPPEMRLLRLSIESDGFTQPIVAYPQADGRYEVVDGFHRLRVGSAKGALRQRLHGYLPIAAIRAGREGDSERIAATIRHNRARGVHGVLPMTAIVVTLLKAGWSEADVARELGMDNDEVLRFKQVSGLPELFREHVYSRSWE 03D4227BD4245390 q9i1y9_pseae-q9i1y9_pseae-1 2 4 unspecified role unspecified role prey prey region Q9I1Y9-2-87 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L S Wed May 02 14:44:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu197ser' Tue Jun 30 16:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu197Ser' 4 unspecified role unspecified role bait bait q9i1y9-88-211 Q9I1Y9-88-211 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 q9i1y9-q9i1y8 2 3 unspecified role unspecified role prey prey region Q9I1Y8-2-247 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region Q9I1Y9-170-211 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L S Wed May 02 18:58:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu197ser' Tue Jun 30 17:12:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu197Ser' physical association physical association figure 1 q9i1y8-q9i1y9 1 3 unspecified role unspecified role bait bait q9i1y8-- Q9I1Y8-- tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation mutation certain certain sequence position certain certain certain sequence position certain L S Wed May 02 15:27:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu197ser' Tue Jun 30 20:24:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu197Ser' physical association physical association figure 4