IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Devarenne T.P. tpd8@tamu.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Devarenne T.P. tpd8@tamu.edu Accepted 2012-MAR-26 by MGT 19-Jun-2012: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Devarenne T.P. tpd8@tamu.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Devarenne T.P. tpd8@tamu.edu Accepted 2012-MAR-26 by MGT cDNA prey library developed from Pst (Pseudomonas syringae pv. tomato) exposed tomato leaves. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation f1jyz6_sollc Autophagy-related protein 100736469 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKQEHDLEKRRAEAARIREKYADRIPVIVEKAEKSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFIDNVLPPTGAIMSAIYDEKKDDDGFLYVTYSGENTFGVLSEL 026430E2B7F5BEE6 f2yhl2_sollc Autophagy-related protein protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGKTFKDEYSYDERLTESQDIIAKYPDRVPVVAERYSKTDLPEMEKKKYLVPRDMSVGQFIHILSGRLHLAPGKALFVFVNNTLPQTTSLIETVYESSKDKDGFLYMCYSSEKTFGGHS E8AE41085DBB5FB1 f1jyz5_sollc Autophagy-related protein 100736468 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGENTFGSF CCF13ECBBE9BB2FD q5i6e9_sollc Adi3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERIPEVRESTRQFPIGAKVAHTFSTSKKEVGIRGFRDFDLAIPIQTWKGKTSYQEEEDLMVDAGTIKRSDDSLEDSGSTSFHGASHPPEPVDTDLMRPVYVPIGQNKADGKCLVKNVSLKGPFLDDLSIRMPNVKPSPSLLSPAESLVEEPNDLGVISSPFTVPRPSQNTETSLPPDSEEKECIWDASLPPSGNVSPLSSIDSTGVVRSMSIVNSCTSTYRSDVLMSDGMLSVDRNYESTKGSIRGDSLESGKTSLSRASDSSGLSDDSNWSNITGSANKPHKGNDPRWKAILAIRARDGILGMSHFKLLKRLGCGDIGSVYLSELSGTRCYFAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEYCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSLRCAVSPTLIRISSDDPSKRGAAFCVQPACIEPTTVCMQPACFLPRLFPQKSKKKTPKPRADSGFQANSMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQLKFPDSPATSYASRDLIRGLLVKEPQNRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPVEPDYPAKYGQVNPVGVGNTSKRVVGADAKSGGKYLDFEFF 87C79B60D952B6B1 adi3-f2yhl2 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association text, section 3.1 adi3-f2yhl2-1 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2a adi3-f2yhl2-2 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2a and 2b f1jyz5-adi3 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2b f1jyz6-adi3-1 1 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2b