mpidb The Microbial Protein Interaction Database CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. J. Bacteriol. (0021-9193) 2011 imex curation Roncarati D., Danielli A., Scarlato V. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions helpy Helicobacter pylori Campylobacter pylori pull down pull down anti tag western anti tag western blot anti tag western Roncarati D., Danielli A., Scarlato V. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. J. Bacteriol. (0021-9193) 2011 imex curation Roncarati D., Danielli A., Scarlato V. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions helpy Helicobacter pylori Campylobacter pylori pull down pull down western blot western blot Immuno blot Immuno blot Roncarati D., Danielli A., Scarlato V. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation o25669_helpy HP_1025 protein protein helpy Helicobacter pylori Campylobacter pylori MCDYDEPLYLISVVAKILGVHPQTLRQYEKEGLIEPSRTDGKMRLYSQRDMDKIKTILRLTRDMGVNLAGVDIILRLKEKLDELDNLNKELQDALHKHSKNTKTPTKNLNTPTNFYELILFKK 52F68AAA62A71157 o25668_helpy HP_1024 protein protein helpy Helicobacter pylori Campylobacter pylori MSKSLYQTLNVSENASQDEIKKSYRRLARQYHPDLNKTKEAEEKFKEINAAYEILSDEEKRRQYDQFGDNMFGGQNFSDFARSRGPSEDLDDILSSIFGKGGFSQRFSQNSQGFSGFNFSNFAPENLDITAALNVSVLDTLLGNKKQVSINNETFSLKIPIGVEEGEKIRVRNKGKTGRTTRGDLLLEIHIEEDEMYRREKDDITQIFDLPLKTALFGGKIEIATWHKTLTLTIPPNTKAMQKFRIKEKGIKNRKTSHVGDLYLQARLILPKTETLSNELKALLEKEL 9143884C0768FFEE o25669-o25668 1 4 unspecified role unspecified role prey prey o25668-- O25668-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait o25669-- O25669-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3A o25669-o25668-1 2 3 unspecified role unspecified role bait bait o25669-- O25669-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association figure 3A