UniProt UniProt http://www.uniprot.org AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. Int. J. Biochem. Cell Biol. (1357-2725) 2011 imex curation Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr Accepted 2012-AUG-14 by MGT 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. Int. J. Biochem. Cell Biol. (1357-2725) 2011 imex curation Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr Accepted 2012-AUG-14 by MGT 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. Int. J. Biochem. Cell Biol. (1357-2725) 2011 imex curation Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr Accepted 2012-AUG-14 by MGT 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. Int. J. Biochem. Cell Biol. (1357-2725) 2011 imex curation Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr Accepted 2012-AUG-14 by MGT 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. AWP1 binds to tumor necrosis factor receptor-associated factor 2 (TRAF2) and is involved in TRAF2-mediated nuclear factor-kappaB signaling. Int. J. Biochem. Cell Biol. (1357-2725) 2011 imex curation Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chang E.J., Ha J., Kang S.S., Lee Z.H., Kim H.H. Origin for HA-AWP1 construct as human according seq length given in fig. 4a. Interactions including GST-AWP1 and (flag) TRAF2 have not been included as the origin of the constructs used is not known. ejchang@amc.seoul.kr Accepted 2012-AUG-14 by MGT 19-Sept-2012: Contacted by IntAct-Help. human spleen cDNA Int. J. Biochem. Cell Biol. (1357-2725) 2011 Only protein-protein interactions imex curation ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN DIP protein Q13546 original sequence version: 158 DIP protein Q13546-1 original sequence version: 140 DIP protein Q13546 original sequence version: 146 DIP protein Q13546-1 original sequence version: 146 DIP protein Q13546 original sequence version: 134 DIP protein Q13546 original sequence version: 109 976E2428D525A9B2 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 zfan6_human AN1-type zinc finger protein 6 Zinc finger A20 domain-containing protein 3 Associated with PRK1 protein ZFAND6 ZA20D3 AWP1 HT032 protein protein human Homo sapiens Human MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI 28B443F2E6D84493 traf2-zfand6 5 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association no figure traf2-zfand6-1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 1A zfand6-traf2-2 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2B zfand6-traf2-3 4 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2c traf2-zfand6-4 4 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 2c traf2-ripk1 2 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 6A TNF-alpha stimulation ZFAND6/AWP1 wild type, but not deletion construct dA20 (containing aa 38-208)