UniProt UniProt http://www.uniprot.org Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Lee H.J., Kang S.J., Lee K., Im H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Accepted 2012-AUG-03 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Lee H.J., Kang S.J., Lee K., Im H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down anti tag western anti tag western blot anti tag western Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Accepted 2012-AUG-03 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Lee H.J., Kang S.J., Lee K., Im H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Accepted 2012-AUG-03 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Human α-synuclein modulates vesicle trafficking through its interaction with prenylated Rab acceptor protein 1. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Lee H.J., Kang S.J., Lee K., Im H. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Only protein-protein interactions in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lee H.J., Kang S.J., Lee K., Im H. Parkinsons - Interactions investigated in the context of Parkinsons disease hanaim@sejong.ac.kr Accepted 2012-AUG-03 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Human brain-specific cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation praf1_human Prenylated Rab acceptor protein 1 PRA1 family protein 1 RABAC1 PRA1 PRAF1 protein protein human Homo sapiens Human MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNLGELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLESKLVLFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEELQMEPV A85BD5BDCF6C23E4 syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 a-synuclein-pra1 2 PRA1 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) syn 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 syn-pra1 3 pra1 5 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association Fig.2 pra1-a-syn 1 pra1 5 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined syn 6 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.3 a-synuclein-pra1 4 syn 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) PRA1 5 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction