UniProt UniProt http://www.uniprot.org Enhanced clathrin-dependent endocytosis in the absence of calnexin. Enhanced clathrin-dependent endocytosis in the absence of calnexin. PLoS ONE 2011 mimix curation Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca Accepted 2012-MAY-31 by MGT mouse brain Matchmaker cDNA library PLoS ONE 2011 mimix curation Enhanced clathrin-dependent endocytosis in the absence of calnexin. Enhanced clathrin-dependent endocytosis in the absence of calnexin. PLoS ONE 2011 mimix curation Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library mouse-n1e-115 Mus musculus neuroblastoma cells n1e-115 Mouse neuroblastoma confocal microscopy confocal microscopy immunostaining immunostaining Li H.D., Liu W.X., Michalak M. Tag visualisation for detection of GFP-SGIP1. marek.michalak@ualberta.ca Accepted 2012-MAY-31 by MGT 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library PLoS ONE 2011 mimix curation Enhanced clathrin-dependent endocytosis in the absence of calnexin. Enhanced clathrin-dependent endocytosis in the absence of calnexin. PLoS ONE 2011 mimix curation Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library mouse-n1e-115 Mus musculus neuroblastoma cells n1e-115 Mouse neuroblastoma anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca Accepted 2012-MAY-31 by MGT 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library PLoS ONE 2011 mimix curation Enhanced clathrin-dependent endocytosis in the absence of calnexin. Enhanced clathrin-dependent endocytosis in the absence of calnexin. PLoS ONE 2011 mimix curation Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca Accepted 2012-MAY-31 by MGT 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library PLoS ONE 2011 mimix curation Enhanced clathrin-dependent endocytosis in the absence of calnexin. Enhanced clathrin-dependent endocytosis in the absence of calnexin. PLoS ONE 2011 mimix curation Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li H.D., Liu W.X., Michalak M. marek.michalak@ualberta.ca Accepted 2012-MAY-31 by MGT 20-Jun-2012: Contacted by JYOTI. mouse brain Matchmaker cDNA library PLoS ONE 2011 mimix curation sgip1_mouse SH3-containing GRB2-like protein 3-interacting protein 1 Endophilin-3-interacting protein Sgip1 protein protein mouse Mus musculus Mouse MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGMQPSPHEPPYHSKAECAREGGKKASKKSNGAPNGFYAEIDWERYNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDVLKNAATVDELKASIGNIALSPSPVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELTSKKPLDDTLALAPLFGPPLESAFDEQKTEVLLDQPEIWGSGQPMNPSTESPELARPFPTGTPPPLPPKTVPATPPRTGSPLTVATGNDQAATEAKIEKLPSISDLDSIFGPVLSPKSVAVNTEEKWVHFSDASPEHVTPELTPREQVVTPPAASDIPADSPAPAPPGPTGSAGPPGPPGPRHVPSPLNLEEVQKKVAEQTFIKDDYLETLSSPKECGLGQRATPPPPPPPTYRTVVSSPGPGSGSGTGTTSGASSPARPATPLVPCSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPPIAPLARAESTSSISSTNSLSAATTPTVGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNPSPAALTFRVVNSSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPASTDLRIDYKYNTDAMSTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN 4909A6D1DACCC775 q8vd37-6 Q8VD37-6 protein protein mouse Mus musculus Mouse calx_mouse Calnexin Canx protein protein mouse Mus musculus Mouse MEGKWLLCLLLVLGTAAVEAHDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDEEEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE 0D9F8FE03434BADC canx-q8vd37_6 1 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association text sgip1-canx 3 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association fig 1B sgip1-canx-1 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association fig 1C canx-sgip1-1 2 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization fig 1D canx-q8vd37_6-1 5 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association fig 1G