I2D I2D β-arrestin1 mediates metastatic growth of breast cancer cells by facilitating HIF-1-dependent VEGF expression. β-arrestin1 mediates metastatic growth of breast cancer cells by facilitating HIF-1-dependent VEGF expression. Oncogene (0950-9232) 2012 imex curation Shenoy S.K., Han S., Zhao Y.L., Hara M.R., Oliver T., Cao Y., Dewhirst M.W. Cancer - Interactions investigated in the context of cancer Cross linking was performed with dithio-bis-maleimidoethane. Subsequently, cell extracts were subjected to immunoprecipitation. Author confirms that Flag-tagged Beta Arrestin constructs were rat. sudha@receptor-biol.duke.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Shenoy S.K., Han S., Zhao Y.L., Hara M.R., Oliver T., Cao Y., Dewhirst M.W. Cancer - Interactions investigated in the context of cancer Cross linking was performed with dithio-bis-maleimidoethane. Subsequently, cell extracts were subjected to immunoprecipitation. Author confirms that Flag-tagged Beta Arrestin constructs were rat. sudha@receptor-biol.duke.edu Accepted 2012-APR-17 by MGT Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database β-arrestin1 mediates metastatic growth of breast cancer cells by facilitating HIF-1-dependent VEGF expression. β-arrestin1 mediates metastatic growth of breast cancer cells by facilitating HIF-1-dependent VEGF expression. Oncogene (0950-9232) 2012 imex curation Shenoy S.K., Han S., Zhao Y.L., Hara M.R., Oliver T., Cao Y., Dewhirst M.W. Cancer - Interactions investigated in the context of cancer Cross linking was performed with dithio-bis-maleimidoethane. Subsequently, cell extracts were subjected to immunoprecipitation. Author confirms that Flag-tagged Beta Arrestin constructs were rat. sudha@receptor-biol.duke.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Shenoy S.K., Han S., Zhao Y.L., Hara M.R., Oliver T., Cao Y., Dewhirst M.W. Cancer - Interactions investigated in the context of cancer Cross linking was performed with dithio-bis-maleimidoethane. Subsequently, cell extracts were subjected to immunoprecipitation. Author confirms that Flag-tagged Beta Arrestin constructs were rat. sudha@receptor-biol.duke.edu Accepted 2012-APR-17 by MGT 19-Jun-2012: Contacted by JYOTI. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR DIP protein P49407 original sequence version: 138 DIP protein P49407 original sequence version: 69 DIP protein P49407 original sequence version: 92 DIP protein P49407 original sequence version: 103 0A3C135092338D10 arrb1_rat Beta-arrestin-1 Arrb1 Arrestin beta-1 protein protein rat Rattus norvegicus (Rat) Rat MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR DIP protein P29066 original sequence version: 70 DIP protein P29066 original sequence version: 90 DIP protein P29066 original sequence version: 79 0A3C07D71B7ABC55 hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D arrb1-hif1a 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 4a Association only seen in cells were treated with CoCl2 (hypoxia mimetic) for 6hr. arrb1-hif1a-4 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 4b Association seen in cells were treated with CoCl2 (hypoxia mimetic). arrb1-hif1a-2 1 4 unspecified role unspecified role bait bait P29066:p.Gln394Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:45:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln394leu' Tue Jun 30 18:17:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln394Leu' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association 4d Association only seen in cells were treated with CoCl2 (hypoxia mimetic) for 6hr. arrb1-hif1a-5 2 3 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 4c, 7d Association seen in cells were treated with CoCl2 (hypoxia mimetic). Addition of thalidomide or imatinib under hypoxia resulted in relocation of beta-arrestin1–HIF-1 complexes to perinuclear compartments.