mpidb The Microbial Protein Interaction Database Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. J. Bacteriol. (0021-9193) 2011 imex curation Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. J. Bacteriol. (0021-9193) 2011 imex curation Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation lrp_ecoli Leucine-responsive regulatory protein lrp alsB ihb livR oppI b0889 JW0872 protein protein ecoli Escherichia coli (strain K12) MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR 2952FB9347A2725C o05140_promi lrp lrp_1 AM402_15495 CEP63_001145 NCTC10975_00505 NCTC11938_01150 E4V60_15205 E4V43_08085 GO498_06800 protein protein proteus mirabilis Proteus mirabilis MIDNKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFISGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNMAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR 1467F81F617456B2 lrp-lrp 1 4 unspecified role unspecified role unspecified role unspecified role 4 unspecified role unspecified role unspecified role unspecified role physical association physical association figure 7 lrp-lrp-1 1 3 unspecified role unspecified role unspecified role unspecified role P0ACJ0:p.[Val2Ile;Ser4Asn] P0ACJ0-2-4 mutation mutation certain certain sequence position certain certain certain sequence position certain V I certain certain sequence position certain certain certain sequence position certain S N Wed May 02 15:02:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val2ile,ser4asn' Tue Jun 30 18:42:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val2Ile;Ser4Asn]' 3 unspecified role unspecified role unspecified role unspecified role P0ACJ0:p.[Val2Ile;Ser4Asn] P0ACJ0-2-4 mutation mutation certain certain sequence position certain certain certain sequence position certain V I certain certain sequence position certain certain certain sequence position certain S N Tue Mar 13 13:52:58 GMT 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val2ile,ser4asn,' Wed May 02 16:29:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val2ile,ser4asn' Tue Jun 30 18:11:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val2Ile;Ser4Asn]' physical association physical association figure 7 lrp-lrp-2 2 4 unspecified role unspecified role unspecified role unspecified role physical association physical association figure 6 Forms octamers in the presence of leucine, hexadecamers in its absence. lrp-lrp-4 2 3 unspecified role unspecified role neutral component neutral component physical association physical association figure 6