mbinfo MBInfo http://www.mechanobio.info/ Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. J. Immunol. (0022-1767) 2011 imex curation Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. J. Immunol. (0022-1767) 2011 Only protein-protein interactions imex curation Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. J. Immunol. (0022-1767) 2011 imex curation Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. J. Immunol. (0022-1767) 2011 Only protein-protein interactions imex curation Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. Hematopoietic lineage cell-specific protein 1 functions in concert with the Wiskott-Aldrich syndrome protein to promote podosome array organization and chemotaxis in dendritic cells. J. Immunol. (0022-1767) 2011 imex curation Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Dehring D.A., Clarke F., Ricart B.G., Huang Y., Gomez T.S., Williamson E.K., Hammer D.A., Billadeau D.D., Argon Y., Burkhardt J.K. Interaction detection: GST pull down. The interactions of Myc-WIP and HA-WASP with Flag-HS1 (Fig 7B) could not be curated since the source of these proteins could not be identified. jburkhar@mail.med.upenn.edu Accepted 2012-OCT-24 by ORCHARD 15-Nov-2012: Contacted by pporras. J. Immunol. (0022-1767) 2011 Only protein-protein interactions imex curation wasp_human Wiskott-Aldrich syndrome protein WAS IMD2 protein protein human Homo sapiens Human MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSALQPPPQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAGDEDEDDEWDD DIP protein P42768 original sequence version: 183 DIP protein P42768 original sequence version: 168 DIP protein P42768 original sequence version: 132 DIP protein P42768 original sequence version: 155 7228428672B7CB78 wipf1_human WAS/WASL-interacting protein family member 1 WIPF1 WIP Wiskott-Aldrich syndrome protein-interacting protein Protein PRPL-2 WASPIP protein protein human Homo sapiens Human MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPPIPR DIP protein O43516 original sequence version: 128 DIP protein O43516 original sequence version: 97 DIP protein O43516 original sequence version: 131 09B7A95E6808A46D hcls1_human Hematopoietic lineage cell-specific protein Hematopoietic cell-specific LYN substrate 1 LckBP1 p75 HCLS1 HS1 protein protein human Homo sapiens Human MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE 20AE72A28DA33DFB wasp_mouse Wiskott-Aldrich syndrome protein homolog Was Wasp protein protein mouse Mus musculus Mouse MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALPPGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVPPHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLPPVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPPPPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQSEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD DIP protein P70315 original sequence version: 114 DIP protein P70315 original sequence version: 125 9C223733C59F0C8A hcls1-wipf1 3 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage 6 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9bact Bacteria 11 13 physical association physical association Fig 7A, 7D(top panel). hcls1-was 3 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wip-binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9bact Bacteria 18 21 physical association physical association Fig 7A, 7C. wipf1-was-6 2 5 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43516:p.Ser436Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:43:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser436ala' Tue Jun 30 19:24:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser436Ala' 7 unspecified role unspecified role prey prey physical association physical association Fig 7D(bottom panel). hcls1-wipf1-2 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined sh3 domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9bact Bacteria 5 unspecified role unspecified role prey prey mouse-bmdc Mus musculus bone marrow-derived dendritic cells bmdm-1 bone marrow-derived macrophage physical association physical association Fig 7E. A tryptophan->tyrosine mutation inhiited the interaction but the mutation could not be added since the amino acid position of the tryptophan was not specified.