mpidb The Microbial Protein Interaction Database EAL domain protein YdiV acts as an anti-FlhD4C2 factor responsible for nutritional control of the flagellar regulon in Salmonella enterica Serovar Typhimurium. EAL domain protein YdiV acts as an anti-FlhD4C2 factor responsible for nutritional control of the flagellar regulon in Salmonella enterica Serovar Typhimurium. J. Bacteriol. (0021-9193) 2011 imex curation Wada T., Morizane T., Abo T., Tominaga A., Inoue-Tanaka K., Kutsukake K. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions salty Salmonella typhimurium far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Wada T., Morizane T., Abo T., Tominaga A., Inoue-Tanaka K., Kutsukake K. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation EAL domain protein YdiV acts as an anti-FlhD4C2 factor responsible for nutritional control of the flagellar regulon in Salmonella enterica Serovar Typhimurium. EAL domain protein YdiV acts as an anti-FlhD4C2 factor responsible for nutritional control of the flagellar regulon in Salmonella enterica Serovar Typhimurium. J. Bacteriol. (0021-9193) 2011 imex curation Wada T., Morizane T., Abo T., Tominaga A., Inoue-Tanaka K., Kutsukake K. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions salty Salmonella typhimurium pull down pull down predetermined predetermined participant predetermined Wada T., Morizane T., Abo T., Tominaga A., Inoue-Tanaka K., Kutsukake K. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation flhc_salty Flagellar transcriptional regulator FlhC flhC STM1924 protein protein salty Salmonella typhimurium MSEKSIVQEARDIQLAMELINLGARLQMLESETQLSRGRLIRLYKELRGSPPPKGMLPFSTDWFMTWEQNIHASMFCNAWQFLLKTGLCSGVDAVIKAYRLYLEQCPQPPEGPLLALTRAWTLVRFVESGLLELSSCNCCGGNFITHAHQPVGSFACSLCQPPSRAVKRRKLSRDAADIIPQLLDEQIEQAV C7334C691ECE3F8D flhd_salty Flagellar transcriptional regulator FlhD flhD STM1925 protein protein salty Salmonella typhimurium MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMANTLGALTLPQMVKLAETNQLVCHFRFDDHQTITRLTQDSRVDDLQQIHTGIMLSTRLLNEVDDTARKKRA 58327B10C1E385D9 ydiv_salty Anti-FlhC(2)FlhD(4) factor YdiV ydiV cdgR STM1344 EAL-like protein YdiV c-di-GMP regulator CdgR protein protein salty Salmonella typhimurium MIASLDELYHSELFFLPVMDENARLVGLEIIATFAAEDGAVRMPTELVAPRLSVEEQYCLFVEKLALLETCQHFFIQHKLIAWLNLPPAISDLLLLDSELFSRAARFPFLELAINENYPGLNQGKNNETLANLAMHFPLMLANFGAGEASTKAIFDGLFKRVMLDKNFIQQRAEMISFEPFMHAIVAQISSSCESLMIAGIDTEAMFARAAPLGFSAFQGGLWPPVPVSQLIKLVQR 558A591D0B8AC895 ydiv-flhc-1 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait q8zps6-- Q8ZPS6-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey association association Figure 7 ydiv-flhd-1 1 4 unspecified role unspecified role prey prey salty Salmonella typhimurium 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined salty Salmonella typhimurium physical association physical association Figure 7