mpidb The Microbial Protein Interaction Database The sporulation protein SirA inhibits the binding of DnaA to the origin of replication by contacting a patch of clustered amino acids. The sporulation protein SirA inhibits the binding of DnaA to the origin of replication by contacting a patch of clustered amino acids. J. Bacteriol. (0021-9193) 2011 imex curation Rahn-Lee L., Merrikh H., Grossman A.D., Losick R. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rahn-Lee L., Merrikh H., Grossman A.D., Losick R. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation dnaa_bacsu Chromosomal replication initiator protein DnaA dnaA dnaH BSU00010 protein protein bacsu Bacillus subtilis MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK DIP protein P05648 original sequence version: 118 DIP protein P05648 original sequence version: 130 666799A0A183C992 sira_bacsu Sporulation inhibitor of replication protein SirA sirA yneE yoxF BSU17900 protein protein bacsu Bacillus subtilis MERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMTEKQIQYITQPIPILHMHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNPVKERNFV 1EBB6477E8D6942D dnaa-sira-1 1 2 unspecified role unspecified role bait bait P05648:p.Phe49Tyr P05648-49-49 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F Y Wed May 02 16:35:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49tyr' Tue Jun 30 15:50:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Tyr' P05648:p.Ala50Val P05648-110-446 mutation mutation certain certain sequence position certain certain certain sequence position certain A V Wed May 02 19:07:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala50val' Tue Jun 30 16:42:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala50Val' region P05648-81-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P05648:p.Asn47Asp P05648-47-47 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N D Wed May 02 14:25:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn47asp' Tue Jun 30 18:51:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn47Asp' P05648:p.Ala50Thr P05648-50-50 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A T Wed May 02 20:19:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala50thr' Tue Jun 30 17:53:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala50Thr' 3 unspecified role unspecified role prey prey physical association physical association table 3; figure 3