mpidb The Microbial Protein Interaction Database The chromosomal mazEF locus of Streptococcus mutans encodes a functional type II toxin-antitoxin addiction system. The chromosomal mazEF locus of Streptococcus mutans encodes a functional type II toxin-antitoxin addiction system. J. Bacteriol. (0021-9193) 2011 imex curation Syed M.A., Koyanagi S., Sharma E., Jobin M.C., Yakunin A.F., Levesque C.M. celine.levesque@dentistry.utoronto.ca 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli bn-page blue native page bn-page ms participant Identification by mass spectrometry ms participant Syed M.A., Koyanagi S., Sharma E., Jobin M.C., Yakunin A.F., Levesque C.M. celine.levesque@dentistry.utoronto.ca Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation The chromosomal mazEF locus of Streptococcus mutans encodes a functional type II toxin-antitoxin addiction system. The chromosomal mazEF locus of Streptococcus mutans encodes a functional type II toxin-antitoxin addiction system. J. Bacteriol. (0021-9193) 2011 imex curation Syed M.A., Koyanagi S., Sharma E., Jobin M.C., Yakunin A.F., Levesque C.M. celine.levesque@dentistry.utoronto.ca 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds ms participant Identification by mass spectrometry ms participant Syed M.A., Koyanagi S., Sharma E., Jobin M.C., Yakunin A.F., Levesque C.M. celine.levesque@dentistry.utoronto.ca Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation q8dw95_strmu SMU_173 protein protein strain atcc 700610 / Streptococcus mutans serotype c MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIGIFAPISNTKRDYPFYVSLEGTESTGKVLLDQLVTIDFNARDYRYVEDIQEDLLDELLARVKVLFEKG BD4562EAEDC096A0 q8dw96_strmu SpoVT-AbrB domain-containing protein SMU_172 protein protein strain atcc 700610 / Streptococcus mutans serotype c MQLVINKWGNSSAIRLPKQLVQELQLQTNDVLDYKVSGNKIILEKVNNIPELTVEDLFKDYQGEPVNVTPALFESVGNEQW C8263B71DA62B418 q8dw95-q8dw96-3 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component q8dw95-- Q8DW95-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5A q8dw95-q8dw96-2 2 3 unspecified role unspecified role neutral component neutral component q8dw95-- Q8DW95-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component physical association physical association figure 5B