IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn Accepted 2012-AUG-07 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn Accepted 2012-AUG-07 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. BTG2 is an LXXLL-dependent co-repressor for androgen receptor transcriptional activity. Biochem. Biophys. Res. Commun. (0006-291X) 2011 imex curation Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu X.D., Meng Q.H., Xu J.Y., Jiao Y., Ge C.M., Jacob A., Wang P., Rosen E.M., Fan S. Cancer - Interactions investigated in the context of cancer CWR22R is the cell line - cannot add correctly as a Cell line and will not add as a Biosource. sjfan@suda.edu.cn Accepted 2012-AUG-07 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation btg2_human Protein BTG2 BTG family member 2 NGF-inducible anti-proliferative protein PC3 BTG2 PC3 protein protein human Homo sapiens Human MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS FFAA1844CC360209 andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 btg2-ar 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P78543:p.[Leu92Ala;Leu96Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:41:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu92ala,leu96ala' Tue Jun 30 19:38:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu92Ala;Leu96Ala]' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma physical association physical association Fig 1B DHT btg2-ar-1 1 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey human-cwr22 CWR22- Human Prostatic carcinoma xenografted cell line cwr22 CWR22 Human Prostatic Carcinoma xenografted cell line physical association physical association Fig 1B-2 DHT ar-btg2 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 1C DHT btg2-ar-3 2 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78543:p.[Leu92Ala;Leu96Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:13:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu92ala,leu96ala' Tue Jun 30 18:33:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu92Ala;Leu96Ala]' region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig 1D DHT