mpidb The Microbial Protein Interaction Database New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. J. Bacteriol. (0021-9193) 2011 imex curation Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. J. Bacteriol. (0021-9193) 2011 imex curation Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. J. Bacteriol. (0021-9193) 2011 imex curation Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. J. Bacteriol. (0021-9193) 2011 imex curation Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation lpta_ecoli Lipopolysaccharide export system protein LptA lptA b3200 JW3167 yhbN protein protein ecoli Escherichia coli (strain K12) MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN BA69198479C68DC1 lptc_ecoli Lipopolysaccharide export system protein LptC lptC b3199 JW3166 yrbK protein protein ecoli Escherichia coli (strain K12) MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP F6BAE79EA232CD95 lptc-lptc 1 6 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association Figure 1b lptc-lpta 4 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait p0adv9-177-191 P0ADV9-177-191 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P0ADV9:p.Gly153Arg P0ADV9-153-153 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 17:02:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly153arg' Tue Jun 30 18:32:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly153Arg' c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 1, 4 lptc-lptc-1 2 6 unspecified role unspecified role prey prey p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 6 lptc-lpta-1 4 6 unspecified role unspecified role bait bait p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey physical association physical association figure 1 lptc-lptc-4 3 6 unspecified role unspecified role neutral component neutral component p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 8 lptc-lptc-5 2 6 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Figure 6