mpidb The Microbial Protein Interaction Database MzrA-EnvZ interactions in the periplasm influence the EnvZ/OmpR two-component regulon. MzrA-EnvZ interactions in the periplasm influence the EnvZ/OmpR two-component regulon. J. Bacteriol. (ISSN:0021-9193) 2010 imex curation Gerken H, Misra R 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Gerken H, Misra R Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (ISSN:0021-9193) 2010 Only protein-protein interactions imex curation mzra_ecoli Modulator protein MzrA mzrA ecfM yqjB JW3067 b3096 protein protein ecoli Escherichia coli (strain K12) MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQAMQWLTRLRDNSHRFG 814A6F43756E7E86 envz_ecoli Sensor histidine kinase EnvZ Osmolarity sensor protein EnvZ envZ ompB perA tpo b3404 JW3367 protein protein ecoli Escherichia coli (strain K12) MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG DIP protein P0AEJ4 original sequence version: 89 DIP protein P0AEJ4 original sequence version: 50 D58444D038722146 mzra-envz 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait P42615:p.Ile78Phe P42615-78-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I F Wed May 02 17:53:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile78phe' Tue Jun 30 18:29:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile78Phe' P42615:p.Asp51Ala P42615-51-51 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:14:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp51ala' Tue Jun 30 18:04:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp51Ala' P42615:p.[Asp51Ala;Ile78Phe] P42615-51-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 10:52:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile78phe,asp51ala' Wed May 02 14:53:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp51ala,ile78phe' Tue Jun 30 17:10:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp51Ala;Ile78Phe]' physical association physical association figure 7 mzra-mzra 1 2 unspecified role unspecified role prey prey P42615:p.[Asp51Ala;Ile78Phe] P42615-51-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain I F Wed May 02 15:29:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp51ala,ile78phe' Tue Jun 30 18:51:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp51Ala;Ile78Phe]' P42615:p.Ile78Phe P42615-78-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I F Wed May 02 15:39:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile78phe' Tue Jun 30 19:07:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile78Phe' P42615:p.Asp51Ala P42615-51-51 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:53:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp51ala' Tue Jun 30 18:08:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp51Ala' 2 unspecified role unspecified role bait bait physical association physical association figure 7