IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. Microbiology (Reading, Engl.) (1350-0872) 2011 imex curation Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl 11-Oct-2012: Contacted by IntAct-Help. Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Only protein-protein interactions PBP3 is also called FtsI ecoli Escherichia coli (strain K12) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl Accepted 2012-OCT-01 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Microbiology (Reading, Engl.) (1350-0872) 2011 Only protein-protein interactions imex curation PBP3 is also called FtsI The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. Microbiology (Reading, Engl.) (1350-0872) 2011 imex curation Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl 11-Oct-2012: Contacted by IntAct-Help. Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Only protein-protein interactions PBP3 is also called FtsI ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl Accepted 2012-OCT-01 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. It is a Cya two-hybrid assay (Karimova et al., 2005; Bertsche et al., 2006). Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Microbiology (Reading, Engl.) (1350-0872) 2011 Only protein-protein interactions imex curation PBP3 is also called FtsI The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. The integral membrane FtsW protein and peptidoglycan synthase PBP3 form a subcomplex in Escherichia coli. Microbiology (Reading, Engl.) (1350-0872) 2011 imex curation Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl 11-Oct-2012: Contacted by IntAct-Help. Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Only protein-protein interactions PBP3 is also called FtsI ecoli Escherichia coli (strain K12) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fraipont C., Alexeeva S., Wolf B., van der Ploeg R., Schloesser M., den Blaauwen T., Nguyen-Disteche M. mng.disteche@ulg.ac.be, t.denblaauwen@uva.nl Accepted 2012-OCT-01 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Linker sequence between the C-terminal of the fluorescent protein and the cell division proteins: YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (Weiss, D.S. et al.,1999, J Bacteriol 181: 508–520) Microbiology (Reading, Engl.) (1350-0872) 2011 Only protein-protein interactions imex curation PBP3 is also called FtsI ftsn_ecoli Cell division protein FtsN ftsN msgA b3933 JW3904 protein protein ecoli Escherichia coli (strain K12) MAQRDYVRRSQPAPSRRKKSTSRKKQRNLPAVSPAMVAIAAAVLVTFIGGLYFITHHKKEESETLQSQKVTGNGLPPKPEERWRYIKELESRQPGVRAPTEPSAGGEVKTPEQLTPEQRQLLEQMQADMRQQPTQLVEVPWNEQTPEQRQQTLQRQRQAQQLAEQQRLAQQSRTTEQSWQQQTRTSQAAPVQAQPRQSKPASSQQPYQDLLQTPAHTTAQSKPQQAAPVARAADAPKPTAEKKDERRWMVQCGSFRGAEQAETVRAQLAFEGFDSKITTNNGWNRVVIGPVKGKENADSTLNRLKMAGHTNCIRLAAGG DIP protein P29131 original sequence version: 125 21CEA5771FF3FB66 ftsi_ecoli Peptidoglycan D,D-transpeptidase FtsI ftsI pbpB b0084 Penicillin-binding protein 3 JW0082 Essential cell division protein FtsI Murein transpeptidase Peptidoglycan synthase FtsI protein protein ecoli Escherichia coli (strain K12) MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWLQVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDISSTDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSYNPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHEIKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSGLYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERVFPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAGVAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEFVINQGEGTGGRS DIP protein P0AD68 original sequence version: 84 This sequence has been withdrawn from Uniprot. C89A403D5980B2CD ftsw_ecoli Probable peptidoglycan glycosyltransferase FtsW ftsW Cell division protein FtsW Cell wall polymerase Lipid II flippase FtsW Peptidoglycan polymerase JW0087 b0089 protein protein ecoli Escherichia coli (strain K12) MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYDRTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPMEFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANYLVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQFIAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGLGNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRFSGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDYETRLEKAQAFVRGSR DIP protein P0ABG4 original sequence version: 39 7935EC952AD9A1F3 pbpb_ecoli Penicillin-binding protein 1B mrcB pbpF ponB b0149 JW0145 Murein polymerase protein protein ecoli Escherichia coli (strain K12) MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGMRILPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN DIP protein P02919 original sequence version: 122 DIP protein P02919 original sequence version: 161 CED0A19FAC73961E ftsi-ftsw-2 1 5 unspecified role unspecified role fluorescence donor fluorescence donor nucl transformation nucleic acid transformation nucl transformation mkusabira orange fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range PBP3 was fused to the C-terminal end of mKusabira Orange (mKO) fluorescent protein (Karasawa et al., 2004), the donor. 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transformation nucleic acid transformation nucl transformation mcherry red fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range FtsW was fused to the C-terminal end of mCherry red fluorescent protein (Shaner et al., 2004), the acceptor proximity proximity close-contact colocalization neighbourhood interaction Figure 2 ftsi-ftsw-3 3 Claudine Fraipont 6 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain Claudine Fraipont 5 unspecified role unspecified role bait bait nucl transformation nucleic acid transformation nucl transformation gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range The fusion protein GFP-Ftsi encoded by pDSW234 has the linker sequence YKEFNNNKA, where YK are the last two residues of GFP and KA are the second and third residues of FtsI (i.e., the initiating methionine of FtsI is absent in the fusion protein) (Weiss, D. S., J. C. Chen, J. M. Ghigo, D. Boyd, and J. Beckwith. 1999. Localization of FtsI (PBP3) to the septal ring requires its membrane anchor, the Z ring, FtsA, FtsQ, and FtsL) physical association physical association Figure 3 ftsi-ftsw-14 2 5 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range The Cya T18 fragment of the adenylate cyclase (Cya) was fused to the N-terminus of PBP3, through a (G4S)3 linker. 6 unspecified role unspecified role neutral component neutral component P0ABG4:p.Pro375Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:04:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro375ala' Tue Jun 30 20:16:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro375Ala' t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range The Cya T25 fragment of the adenylate cyclase (Cya) was fused to the N-terminus of FtsW mutant through a (G4S)3 linker P0ABG4:p.Pro368Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:13:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro368ala' Tue Jun 30 19:06:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro368Ala' physical association physical association Figure 4 ftsi-ftsw-16 2 6 unspecified role unspecified role neutral component neutral component t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range The Cya T25 fragments of the adenylate cyclase (Cya) was fused to the N-terminus of FtsW through a (G4S)3 linker. 5 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation P0AD68:p.Arg23Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R C Wed May 02 20:27:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg23cys' Tue Jun 30 18:29:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg23Cys' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range The Cya T18 fragment of the adenylate cyclase (Cya) was fused to the N-terminus of PBP3 mutants through a (G4S)3 linker. physical association physical association Figure 4, Table 2 ftsi-ftsw-9 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transformation nucleic acid transformation nucl transformation mcherry red mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role fluorescence donor fluorescence donor nucl transformation nucleic acid transformation nucl transformation mkusabira orange fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Figures 2 & 5 ftsi-ftsi 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transformation nucleic acid transformation nucl transformation region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mcherry red fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role fluorescence donor fluorescence donor nucl transformation nucleic acid transformation nucl transformation mkusabira orange fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 44 40 proximity proximity close-contact colocalization neighbourhood interaction Figure 2 & 5 ftsw-mrcb-3 2 7 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 2 ftsw-mrcb-4 2 6 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain P0ABG4:p.Pro375Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:52:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro375ala' Tue Jun 30 16:02:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro375Ala' P0ABG4:p.Pro368Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 18:24:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro368ala' Tue Jun 30 16:33:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro368Ala' t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 2 ftsn-ftsw-5 2 4 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0ABG4:p.Pro368Ala mutation mutation certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:50:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro368ala' Tue Jun 30 17:23:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro368Ala' ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain P0ABG4:p.Pro375Ala mutation mutation certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:58:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro375ala' Tue Jun 30 15:36:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro375Ala' physical association physical association Table 2 ftsn-ftsw-4 2 4 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Table 2 ftsi-ftsw-13 2 5 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation t18-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component nucl transformation nucleic acid transformation nucl transformation ha-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag certain certain sequence position certain certain certain sequence position certain t25-(g4s)3 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0ABG4:p.Pro375Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:10:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro375ala' Tue Jun 30 18:08:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro375Ala' P0ABG4:p.Pro368Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:57:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro368ala' Tue Jun 30 17:52:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro368Ala' physical association physical association Table 2