NTNU NTNU, Norwegian University of Science and Technology www.ntnu.no/home Direct transcriptional regulation of Gata4 during early endoderm specification is controlled by FoxA2 binding to an intronic enhancer. Direct transcriptional regulation of Gata4 during early endoderm specification is controlled by FoxA2 binding to an intronic enhancer. Dev. Biol. (0012-1606) 2010 imex curation Rojas A., Schachterle W., Xu S.M., Martin F., Black B.L. anabel.rojas@cabimer.es 11-Jun-2014: Contacted by IntAct-Help. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Rojas A., Schachterle W., Xu S.M., Martin F., Black B.L. anabel.rojas@cabimer.es Accepted 2014-MAY-27 by ORCHARD Dev. Biol. (0012-1606) 2010 imex curation Direct transcriptional regulation of Gata4 during early endoderm specification is controlled by FoxA2 binding to an intronic enhancer. Direct transcriptional regulation of Gata4 during early endoderm specification is controlled by FoxA2 binding to an intronic enhancer. Dev. Biol. (0012-1606) 2010 imex curation Rojas A., Schachterle W., Xu S.M., Martin F., Black B.L. anabel.rojas@cabimer.es 11-Jun-2014: Contacted by IntAct-Help. rat-ar42j Rattus norvegicus ar42j Rat AR42J pancreatic epithelial tumour cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Rojas A., Schachterle W., Xu S.M., Martin F., Black B.L. anabel.rojas@cabimer.es Accepted 2014-MAY-27 by ORCHARD Dev. Biol. (0012-1606) 2010 imex curation foxa2_mouse Hepatocyte nuclear factor 3-beta Foxa2 Hnf3b Tcf-3b Tcf3b Forkhead box protein A2 protein protein mouse Mus musculus Mouse MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGGGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAASSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGAPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS 2F20F15AB372F557 foxa2_rat Hepatocyte nuclear factor 3-beta Foxa2 Hnf3b Tcf-3b Tcf3b Forkhead box protein A2 protein protein rat Rattus norvegicus (Rat) Rat MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDFLKVPRAPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCENELALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS 9FF754142C194055 gata4_g4_mouse_dna Transcription factor GATA-4_G4 Forkhead site nucleic acid nucleic acid mouse Mus musculus Mouse GGGGGTTAATTATAATCACAAATAAACGCAGAAGTCTCAAAG gata4_rat_gene GATA binding protein 4 gene gene rat Rattus norvegicus (Rat) Rat foxa2-gata4-4 1 Gata4 G4 Forkhead site 5 unspecified role unspecified role prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated in vitro In vitro direct interaction direct interaction Figure 6 foxa2-gata4 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait association association Fig. 6C