mpidb The Microbial Protein Interaction Database The LysR-type transcriptional regulator QseD alters type three secretion in enterohemorrhagic Escherichia coli and motility in K-12 Escherichia coli. The LysR-type transcriptional regulator QseD alters type three secretion in enterohemorrhagic Escherichia coli and motility in K-12 Escherichia coli. J. Bacteriol. (0021-9193) 2010 imex curation Habdas B.J., Smart J., Kaper J.B., Sperandio V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Habdas B.J., Smart J., Kaper J.B., Sperandio V. Accepted 2013-FEB-06 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation lrha_eco57 Probable HTH-type transcriptional regulator LrhA lrhA ECs3173 Z3549 protein protein eco57 Escherichia coli O157:H7 MISANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQMQRLEQLVGKELFARHGRNKLLTEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIGASDESADTILPFLLNRVSSVYPKLALDVRVKRNAYMAEMLESQEVDLMVTTHRPSAFKALNLRTSPTHWYCAAEYVLQKGEPIPLVLLDDPSPFRDMVLATLNKADIPWRLAYVASTLPAVRAAVKAGLGVTARPVEMMSPDLRVLSGVDGLPPLPDTEYLLCYDPSSNNELAQVIYQAMESYHNPWQYSPISAPEGDDSLLIERDIE 98A5F2236690C38C qsed_eco57 HTH domain-truncated transcriptional regulator QseD qseD Quorum-sensing regulator protein D Z5926 protein protein eco57 Escherichia coli O157:H7 MTPLQLSEQGKIFHSQIRHLLQQLESNLAELRGGSDYAQRKIKIAAAHSLSLGLLPSIISQMPPLFTWAIEAIDVDEAVDKLREGQSDCIFSFHDEDLLEAPFDHIRLFESQLFPVCASDEHGEALFDLVQPHFPLLNYSRNSYMGRLINRTLTRHSELSFSTFFVSSMSELLKQVALDGCGIAWLPEYAIQQEIRSGQLVVLNRDELVIPIQAYAYRMNTRMNPVAERFWRELRELEIVLS 942D79E0CF5B2B12 aaer_ecoli HTH-type transcriptional activator AaeR yhcS aaeR b3243 JW3212 protein protein ecoli Escherichia coli (strain K12) MERLKRMSVFAKVVEFGSFTAAARQLQMSVSSISQTVSKLEDELQVKLLNRSTRSIGLTEAGRIYYQGCRRMLHEVQDVHEQLYAFNNTPIGTLRIGCSSTMAQNVLAGLTAKMLKEYPGLSVNLVTGIPAPDLIADGLDVVIRVGALQDSSLFSRRLGAMPMVVCAAKSYLTQYGIPEKPADLSSHSWLEYSVRPDNEFELIAPEGISTRLIPQGRFVTNDPMTLVRWLTAGAGIAYVPLMWVINEINRGELEILLPRYQSDPRPVYALYTEKDKLPLKVQVVINSLTDYFVEVGKLFQEMHGRGKEK 22DF64653AF4BE2F aaer-aaer 1 4 unspecified role unspecified role prey prey p67662-- P67662-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait p67662-- P67662-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 6; Figure 6 lrha-lrha 1 2 unspecified role unspecified role prey prey q8vwe6-- Q8VWE6-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait q8vwe6-- Q8VWE6-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 6; Figure 6 qsed-qsed 1 3 unspecified role unspecified role prey prey q8x487-- Q8X487-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait q8x487-- Q8X487-- sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 6; Figure 6