mpidb The Microbial Protein Interaction Database Cochaperone interactions in export of the type III needle component PscF of Pseudomonas aeruginosa. Cochaperone interactions in export of the type III needle component PscF of Pseudomonas aeruginosa. J. Bacteriol. (0021-9193) 2010 imex curation Ple S., Job V., Dessen A., Attree I. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Ple S., Job V., Dessen A., Attree I. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation pscg_pseae Type III export protein PscG Pseudomonas secretion protein G PA1720 pscG protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MDTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQDEAARLIRISSLANQGRYQEALAFAHGNPWPALEPWFALCEWHLGLGAALDRRLAGLGGSSDPALADFAAGMRAQVRT DIP protein P95435 original sequence version: 75 3F546AA0645050B7 psce_pseae Type III export protein PscE Pseudomonas secretion protein E PA1718 pscE protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MMTALETRLSVADGTHAAALRQRLQAALAECRRELARGACPEHFQFLQQQARALEGGLGILSQLTED DIP protein Q9I317 original sequence version: 66 62339AFECA931617 psce-pscg 1 3 unspecified role unspecified role bait bait Q9I317:p.Leu20Ser Q9I317-20-20 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S Wed May 02 16:24:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu20ser' Tue Jun 30 16:46:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu20Ser' q9i317-- Q9I317-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9I317:p.Gly57Asp Q9I317-57-57 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G D Wed May 02 15:11:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly57asp' Tue Jun 30 18:48:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly57Asp' 2 unspecified role unspecified role prey prey P95435:p.[Ile28Ser;Trp31Ser] P95435-28-31 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I S certain certain sequence position certain certain certain sequence position certain W S Wed May 02 16:52:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile28ser,trp31ser' Tue Jun 30 15:54:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile28Ser;Trp31Ser]' P95435:p.Leu5Ser P95435-5-5 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S Wed May 02 20:01:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu5ser' Tue Jun 30 19:29:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu5Ser' P95435:p.[Leu5Ser;Leu9Ser] P95435-5-9 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L S Fri Jul 22 11:00:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu9ser,leu5ser' Wed May 02 15:52:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu5ser,leu9ser' Tue Jun 30 19:33:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu5Ser;Leu9Ser]' P95435:p.Ile28Ser P95435-28-28 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I S Wed May 02 15:36:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile28ser' Tue Jun 30 20:12:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile28Ser' P95435:p.Leu9Ser P95435-9-9 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L S Wed May 02 17:46:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu9ser' Tue Jun 30 19:44:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu9Ser' physical association physical association Figure 2