UniProt UniProt http://www.uniprot.org The crystal structure of PPIL1 bound to cyclosporine A suggests a binding mode for a linear epitope of the SKIP protein. The crystal structure of PPIL1 bound to cyclosporine A suggests a binding mode for a linear epitope of the SKIP protein. PLoS ONE 2010 mimix curation Stegmann C.M., Luhrmann R., Wahl M.C. mwahl@gwdg.de 18-Dec-2012: Contacted by IntAct-Help. in vitro In vitro peptide array peptide array anti tag western anti tag western blot anti tag western Stegmann C.M., Luhrmann R., Wahl M.C. mwahl@gwdg.de Accepted 2012-NOV-26 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. PLoS ONE 2010 mimix curation The crystal structure of PPIL1 bound to cyclosporine A suggests a binding mode for a linear epitope of the SKIP protein. The crystal structure of PPIL1 bound to cyclosporine A suggests a binding mode for a linear epitope of the SKIP protein. PLoS ONE 2010 mimix curation Stegmann C.M., Luhrmann R., Wahl M.C. mwahl@gwdg.de 18-Dec-2012: Contacted by IntAct-Help. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Stegmann C.M., Luhrmann R., Wahl M.C. mwahl@gwdg.de Accepted 2012-NOV-26 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. PLoS ONE 2010 mimix curation ppil1_human Peptidyl-prolyl cis-trans isomerase-like 1 PPIL1 Rotamase PPIL1 CYPL1 CGI-124 UNQ2425/PRO4984 protein protein human Homo sapiens Human MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG 2872DC3336CD05E4 snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE DIP protein Q13573 original sequence version: 156 0CC75E0D0B2CF842 snw1-ppil1-2 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait direct interaction direct interaction 1 snw1-ppil1-3 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey direct interaction direct interaction 2