mpidb The Microbial Protein Interaction Database Functional analysis of the stability determinant AlfB of pBET131, a miniplasmid derivative of bacillus subtilis (natto) plasmid pLS32. Functional analysis of the stability determinant AlfB of pBET131, a miniplasmid derivative of bacillus subtilis (natto) plasmid pLS32. J. Bacteriol. (0021-9193) 2010 imex curation Tanaka T. teruot@scc.u-tokai.ac.jp Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka T. teruot@scc.u-tokai.ac.jp Accepted 2013-FEB-16 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation e9rjg4_bacna alfA protein protein bacillus subtilis su Bacillus subtilis subsp. natto MTLTTVIDIGNFSTKYAYKDKKQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREEQMYFGNTRKGHMEGQIRLVYALYTIFKETGKKEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALNFSDSLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYDYPIVCTGGKAEEMKECLENVGYSTVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA 8E57CE0E2246620B e9rjg5_bacna alfB protein protein bacillus subtilis su Bacillus subtilis subsp. natto MSREDNFMYQINWNKKKYPEICKALEDAKNRTGGIAWYLRELIQKDLEEKRGGVVRSTPVYETVDQEVQNDPPKPSKAKIETIELPDDSGGFL 58218ABC42839A51 alfa-alfb 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 8A alfb-alfb 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig. 8B alfa-alfa 1 2 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig. 8B