mpidb The Microbial Protein Interaction Database Identification of conserved amino acid residues of the Salmonella sigmaS chaperone Crl involved in Crl-sigmaS interactions. Identification of conserved amino acid residues of the Salmonella sigmaS chaperone Crl involved in Crl-sigmaS interactions. J. Bacteriol. (0021-9193) 2010 imex curation Monteil V., Kolb A., D'Alayer J., Beguin P., Norel F. Only protein-protein interactions ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Monteil V., Kolb A., D'Alayer J., Beguin P., Norel F. Accepted 2013-FEB-16 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation crl_salti Sigma factor-binding protein Crl STY0364 t2531 crl protein protein salti Salmonella typhi MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA 0619C3D79FFF7897 q8xfg1_salti Ferric uptake regulation protein G2227_18000 G2244_07455 G3982_004662 G3V49_001402 G4I71_002045 G4L28_003008 G4P30_003029 G4Y41_001425 G6Z97_003969 G7104_000997 G7106_001837 G7109_001354 G7112_001179 fur G7113_001401 G7114_000572 G7122_003401 G7123_000933 G7124_000577 G7125_001837 G7129_001785 G7130_001882 G7131_001543 G7132_001754 G7134_001837 G7136_000573 CAJ76_14870 CAJ80_21135 CAJ85_05435 CAL67_18235 CB224_06795 CC884_16340 CC907_04850 CC972_09165 D4Z37_11885 D6Q30_21375 DKA88_06745 DNM71_11300 DNV09_14625 DS261_07415 DUQ91_12495 DUV11_10685 DVG36_16165 EBC38_16605 EID90_15340 ELQ62_15575 EU445_07215 EVI00_12225 F9R11_07585 F9Y21_07125 FI137_14240 GDI29_12220 ZZ17_23000 STY0731 t2182 G7138_004414 G7161_002475 G7162_001761 G7163_001543 G7166_003754 G7169_001460 G7877_001837 G7880_001827 G7885_001401 G7889_000573 G7899_001503 G7906_001504 G7908_001234 G7913_000573 G7915_000627 G7919_001434 G7922_001654 G7Z58_000573 G7Z60_000124 G7Z65_001705 G8967_001829 G8969_000929 G8970_001775 G8976_000996 G9264_001782 G9C68_001565 G9X37_000491 GND71_001455 protein protein salti Salmonella typhi MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHDDATK AA7CA68AE7B51348 rpos_salti RNA polymerase sigma factor RpoS rpoS Sigma-38 katF STY3049 t2825 Sigma S protein protein salti Salmonella typhi MSQNTLKVHDLNEDAEFDENGVEAFDEKALSEEEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE 4400E48DEB358ECC fur-fur 1 3 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Table 3 p0a2e6-crl 1 4 unspecified role unspecified role bait bait region P0A2E6-1-71 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role prey prey Q8XH11:p.Gly80Ala Q8XH11-80-80 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:14:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly80ala' Tue Jun 30 19:57:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly80Ala' Q8XH11:p.Arg51Ala Q8XH11-51-51 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:02:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg51ala' Tue Jun 30 17:31:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg51Ala' Q8XH11:p.Tyr22Ala Q8XH11-22-22 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:59:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr22ala' Tue Jun 30 17:38:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr22Ala' Q8XH11:p.Glu52Ala Q8XH11-52-52 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 17:24:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu52ala' Tue Jun 30 18:57:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu52Ala' Q8XH11:p.Gly55Ala Q8XH11-55-55 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A Wed May 02 15:08:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly55ala' Tue Jun 30 15:38:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly55Ala' Q8XH11:p.Trp82Ala Q8XH11-82-82 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:28:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp82ala' Tue Jun 30 19:23:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp82Ala' Q8XH11:p.Trp57Ala Q8XH11-57-57 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:18:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp57ala' Tue Jun 30 18:04:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp57Ala' Q8XH11:p.Phe53Ala Q8XH11-53-53 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:08:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe53ala' Tue Jun 30 17:15:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe53Ala' Q8XH11:p.Trp56Ala Q8XH11-56-56 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Wed May 02 17:06:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp56ala' Tue Jun 30 18:19:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp56Ala' physical association physical association table 3