mpidb The Microbial Protein Interaction Database ExsD inhibits expression of the Pseudomonas aeruginosa type III secretion system by disrupting ExsA self-association and DNA binding activity. ExsD inhibits expression of the Pseudomonas aeruginosa type III secretion system by disrupting ExsA self-association and DNA binding activity. J. Bacteriol. (0021-9193) 2010 imex curation Brutinel E.D., Vakulskas C.A., Yahr T.L. Only protein-protein interactions ecolx Escherichia coli gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Brutinel E.D., Vakulskas C.A., Yahr T.L. Accepted 2013-FEB-16 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation ExsD inhibits expression of the Pseudomonas aeruginosa type III secretion system by disrupting ExsA self-association and DNA binding activity. ExsD inhibits expression of the Pseudomonas aeruginosa type III secretion system by disrupting ExsA self-association and DNA binding activity. J. Bacteriol. (0021-9193) 2010 imex curation Brutinel E.D., Vakulskas C.A., Yahr T.L. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Brutinel E.D., Vakulskas C.A., Yahr T.L. Accepted 2013-FEB-16 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation exsd_pseae Transcriptional antiactivator ExsD exsD PA1714 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MEQEDDKQYSREAVFAGRRVSVVGSDARSRGRVPGYASSSLYRESGIISARQLALLQRMLPRLRLEQLFRCEWLQQRLARGLALGREEVRQILLCAAQDDDGWCSELGDRVNLAVPQSMIDWVLLPVYGWWESLLDQAIPGWRLSLVELETQSRQLRVKSEFWSRVAELEPEQAREELARVAKCQARTQEQVAELAGKLETASALAKSAWPNWQRGMATLLASGGLAGFEPIPEVLECLWQPLCRLDDDVGAADAVQAWLHERNLCQAQDHFYWQS A6C56685A704124A exsa_pseae HTH-type transcriptional regulator ExsA exsA PA1713 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MQGAKSLGRKQITSCHWNIPTFEYRVNKEEGVYVLLEGELTVQDIDSTFCLAPGELLFVRRGSYVVSTKGKDSRILWIPLSAQFLQGFVQRFGALLSEVERCDEPVPGIIAFAATPLLAGCVKGLKELLVHEHPPMLACLKIEELLMLFAFSPQGPLLMSVLRQLSNRHVERLQLFMEKHYLNEWKLSDFSREFGMGLTTFKELFGSVYGVSPRAWISERRILYAHQLLLNSDMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSRSRQGKDECRAKNN 4823D0E9135E0BB7 exsc_pseae Transcriptional anti-antiactivator ExsC exsC PA1710 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MDLTSKVNRLLAEFAGRIGLPSLSLDEEGMASLLFDEQVGVTLLLLAERERLLLEADVAGIDVLGEGIFRQLASFNRHWHRFDLHFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCDSDREAVAAVGMRV A53BEB27270EA737 exsa-exsa-1 1 4 unspecified role unspecified role unspecified role unspecified role region P26993-- lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role unspecified role unspecified role p26993-- P26993-- lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6A exsc-exsd-1 2 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association Fig. 3A exsa-exsd 2 4 unspecified role unspecified role bait bait region P26993-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association Fig. 3 exsa-exsd-1 1 4 unspecified role unspecified role unspecified role unspecified role region P26993-- lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role unspecified role unspecified role region lexa dna bd lexa dna binding domain lexa dna bd undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6A