UniProt UniProt http://www.uniprot.org GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. Biochem. J. (0264-6021) 2009 mimix curation Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn 15-Nov-2012: Contacted by pporras. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2009 mimix curation GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. Biochem. J. (0264-6021) 2009 mimix curation Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn 15-Nov-2012: Contacted by pporras. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2009 mimix curation GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. Biochem. J. (0264-6021) 2009 mimix curation Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn 15-Nov-2012: Contacted by pporras. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Accepted 2012-OCT-17 by PPORRAS 15-Nov-2012: Contacted by pporras. Biochem. J. (0264-6021) 2009 mimix curation rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC DIP protein P20338 original sequence version: 151 983D65E1162741B0 gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ BC283A445E50A652 gdib_human Rab GDP dissociation inhibitor beta Guanosine diphosphate dissociation inhibitor 2 GDI2 RABGDIB protein protein human Homo sapiens Human MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED DIP protein P50395 original sequence version: 92 DIP protein P50395 original sequence version: 137 CE186A2E3A47FCC9 rab10_mouse Ras-related protein Rab-10 Rab10 protein protein mouse Mus musculus Mouse MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC DIP protein P61027 original sequence version: 110 7F02B8E8E46EE1E8 rab10-gdi1 2 5 unspecified role unspecified role neutral component neutral component mko kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2B rab10-gdi2 2 7 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component mkotag kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 2C rab10-gdi1-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig 4 rab10-gdi2-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig 4 gdi1-rab10 3 7 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component mko kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 5 gdi2-rab10 3 7 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component mkotag kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig5 gdi1-rab4a 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig 7A rab4a-gdi2 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig 7A gdi1-rab4a-1 3 4 unspecified role unspecified role neutral component neutral component mkorab4 kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component egfpgdi1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 7B gdi2-rab4a 3 4 unspecified role unspecified role neutral component neutral component mkorab4 kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component egfpgdi1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 7B