mpidb The Microbial Protein Interaction Database RsmC of Erwinia carotovora subsp. carotovora negatively controls motility, extracellular protein production, and virulence by binding FlhD and modulating transcriptional activity of the master regulator, FlhDC. RsmC of Erwinia carotovora subsp. carotovora negatively controls motility, extracellular protein production, and virulence by binding FlhD and modulating transcriptional activity of the master regulator, FlhDC. J. Bacteriol. (0021-9193) 2009 imex curation Chatterjee A., Cui Y., Chatterjee A.K. chatterjeeas@missouri.edu Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chatterjee A., Cui Y., Chatterjee A.K. chatterjeeas@missouri.edu Accepted 2013-FEB-12 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation flhd_ecoli Flagellar transcriptional regulator FlhD flhD flbB b1892 JW1881 protein protein ecoli Escherichia coli (strain K12) MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA 593287239E9A4C16 c7fdi1_peccc Flagellar transcriptional regulator FlhC flhC RC98_04800 EGD00_08595 protein protein peccc Pectobacterium carotovorum subsp. carotovorum MAEKSIVQEAKDIQLAMELISLGARLQMLESETQLSRGRLIKLYKELRGSPPPKGMLPFSTDWFMTWEQNIHSSMFYNAYSFLIKNGQCSGVEAVIKSYRLYLEQCAPQSDSPLLALTRAWTLVRFVDSGMLQLSSCNCCKGMFITHAHQPKNSFVCSLCQPPSRAVKRRKLSQNLADIIPQLLDEQVKHAV 3F0919FF06639DDB c7fdi0_peccc Flagellar transcriptional regulator FlhD flhD protein protein peccc Pectobacterium carotovorum subsp. carotovorum MGNMGTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGINDEMADILMQLTLPQMVKLAETNQLICHFRFNDHNTIKILTQESRVDDLQQIHTGILLSSHLLQQLTSKEENLPKKRA A5A5C6CF5C904094 q9r2p5_peccc RC98_14720 hexY rsmC protein protein peccc Pectobacterium carotovorum subsp. carotovorum MSLIFGRNEILGMLSQPVQNDRRAVAVIDEKCKVVCANSAFNAHFGLRAEMNTPVSIDDVLPINVKFAYHDFMTNSNMLSTRVVSDLLSDGFTKKQLSTLSFSKLNVENRVLSLLILNQDAVEPSTNLAS F2AD26C493FDD447 flhd_serma Flagellar transcriptional regulator FlhD flhD protein protein serma Serratia marcescens MGNMGTSELLKHIYDINLSYLLLAQRLINDEKASAMFRLGIDETMADALAQLTLPQMVKLAETNQLVCHFRFNESQTIERLTKESRVDDLQQIHTGILLSSHLLQELSSKDASPTKKRA 15EBFC519F79B65A hexy-flhd 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 7 hexy-flhd-1 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 7 hexy-flhd-3 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Table 6 hexy-flhd-4 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role ancillary ancillary 5 unspecified role unspecified role bait bait physical association physical association Table 6