mpidb The Microbial Protein Interaction Database The conserved C-terminal tail of FtsZ is required for the septal localization and division inhibitory activity of MinC(C)/MinD. The conserved C-terminal tail of FtsZ is required for the septal localization and division inhibitory activity of MinC(C)/MinD. Mol. Microbiol. (0950-382X) 2009 imex curation Shen B., Lutkenhaus J. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shen B., Lutkenhaus J. Accepted 2013-FEB-12 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation The conserved C-terminal tail of FtsZ is required for the septal localization and division inhibitory activity of MinC(C)/MinD. The conserved C-terminal tail of FtsZ is required for the septal localization and division inhibitory activity of MinC(C)/MinD. Mol. Microbiol. (0950-382X) 2009 imex curation Shen B., Lutkenhaus J. Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation weight by staining molecular weight estimation by staining weight by staining Shen B., Lutkenhaus J. Accepted 2013-FEB-12 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation zipa_ecoli Cell division protein ZipA zipA FtsZ interacting protein A JW2404 b2412 protein protein ecoli Escherichia coli (strain K12) MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDDEGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPHPAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDANA DIP protein P77173 original sequence version: 111 A20F119A153A782B mind_ecoli Septum site-determining protein MinD Cell division inhibitor MinD minD b1175 JW1164 protein protein ecoli Escherichia coli (strain K12) MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEEEKKGFLKRLFGG DIP protein P0AEZ3 original sequence version: 74 DIP protein P0AEZ3 original sequence version: 39 0D2C4C0976B77D2C ftsa_ecoli Cell division protein FtsA ftsA divA b0094 JW0092 protein protein ecoli Escherichia coli (strain K12) MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITCHNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEKRVTASVGSWIKRLNSWLRKEF DIP protein P0ABH0 original sequence version: 67 C2475377A229B982 ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD DIP protein P0A9A6 original sequence version: 83 DIP protein P0A9A6 original sequence version: 82 DIP protein P0A9A6 original sequence version: 72 B3A53340367DBBA0 minc_ecoli Septum site-determining protein MinC minC b1176 JW1165 protein protein ecoli Escherichia coli (strain K12) MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKEKAPRPAPTPQAPAQNTTPVTKTRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN DIP protein P18196 original sequence version: 116 DIP protein P18196 original sequence version: 82 DIP protein P18196 original sequence version: null E4283A6AD850DAD0 ftsa-ftsz-8 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey P0A9A6:p.Ile374Val mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I V Wed May 02 18:45:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile374val' Tue Jun 30 16:56:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile374Val' physical association physical association ftsz-zipa-3 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 minc-mind 2 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction Fig. 4 ftsz-ftsz-13 2 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association Supp. Fig. 3 ftsz-minc 2 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component P0A9A6:p.Ile374Val mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I V Wed May 02 18:09:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile374val' Tue Jun 30 18:44:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile374Val' ecolx Escherichia coli physical association physical association Fig. 4