mpidb The Microbial Protein Interaction Database In vivo interactions between toxin-antitoxin proteins epsilon and zeta of streptococcal plasmid pSM19035 in Saccharomyces cerevisiae. In vivo interactions between toxin-antitoxin proteins epsilon and zeta of streptococcal plasmid pSM19035 in Saccharomyces cerevisiae. J. Bacteriol. (0021-9193) 2009 imex curation Zielenkiewicz U., Kowalewska M., Kaczor C., Ceglowski P. ulazet@ibb.waw.pl Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zielenkiewicz U., Kowalewska M., Kaczor C., Ceglowski P. ulazet@ibb.waw.pl Accepted 2013-FEB-08 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation eatx_strpy Antitoxin epsilon protein protein strpy Streptococcus pyogenes MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA DIP protein Q57231 original sequence version: 53 31628C7F2FDE4B50 ztox_strpy Toxin zeta UDP-N-acetylglucosamine kinase protein protein strpy Streptococcus pyogenes MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI DIP protein Q54944 original sequence version: 61 B0C6282EE5B2210F ztox-eatx 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey region Q57231-1-12 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association table 3, 4 ztox-eatx-1 1 2 unspecified role unspecified role prey prey region Q57231-1-66 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region Q57231-1-29 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait physical association physical association table 3, 4 eatx-ztox 1 2 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association table 3