mpidb The Microbial Protein Interaction Database Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Mol. Microbiol. (0950-382X) 2009 imex curation Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Mol. Microbiol. (0950-382X) 2009 imex curation Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Protein-protein interactions between CbbR and RegA (PrrA), transcriptional regulators of the cbb operons of Rhodobacter sphaeroides. Mol. Microbiol. (0950-382X) 2009 imex curation Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa western blot western blot Immuno blot Immuno blot Dangel A.W., Tabita F.R. Proteins extracted from thepolyacrylamide gels and then denatured and separated on SDS-PAGE prior to western blot Accepted 2013-JAN-10 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation cbbr_cersp HTH-type transcriptional regulator CbbR RuBisCO operon transcriptional regulator cbbR protein protein rhosh Rhodobacter sphaeroides Rhodopseudomonas sphaeroides MVRLDAITLKQLRALVAVAGSASLTGGATRLGLTPPAIHSQIRNLEEAFGVPLLHRPPETGSFTPTLAGIAVLEAAQRIEVILSQCSYQVMAVSEGRAGQVTLGVVSTGRYFAPRLVKMLSLACPEIRIALRVGNREQLIDDLARHMVDLAVMGRPPRQPEVASVALGPHPHGIVAPPDHPLAGLAEVPVPDLLSQTFLARAEGSGTRVLMSRYLDRLGEGQVVDLIEMDSNETIKQSVIAGLGLAFLSLHVVMDELRFGQLVQLAAPGLPIERHWFLVHPVDRPLNPAALRVQGEIVKLKGAYLPGAPA A98E1DF40B1DD578 probe-0 Probe-0 ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GATTGGATCCACCATTTCCAAATTCCCGAACAG f5m310_rhosh RSWS8N_13030 protein protein rhodobacter sphaeroides ws8n Rhodobacter sphaeroides WS8N MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR The sequence has been withdrawn from uniprot. D73447E037F1285B rega_cers4 Photosynthetic apparatus regulatory protein RegA Response regulator PrrA prrA RSP_1518 RHOS4_00930 regA protein protein rhos4 Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) MAEDLVFELGADRSLLLVDDDEPFLKRLAKAMEKRGFVLETAQSVAEGKAIAQARPPAYAVVDLRLEDGNGLDVVEVLRERRPDCRIVVLTGYGAIATAVAAVKIGATDYLSKPADANEVTHALLAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR D73447E037F1285B probe_0-cbbr-1 2 5 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey physical association physical association Fig. 4 cbbr-rega-1 1 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6 Cross-linking occured in the presence of DNA. probe_0-cbbr-2 2 5 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 probe_0-cbbr-3 3 5 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey physical association physical association Fig. 4